TkA06G027470 | RubberDandelionOmics

Gene overview

TkA06G027470

Reference: TK1151 Chr: Chr06 Coordinates: 7427582-7430559 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2122 bp · TkA06G027470|TK1151|cDNA

GTCAAACGAGGGGTAGTTCAAACAAAAAACAACTACCATTTTACAAATGTAATTTATGTGCAAATGGAAGGGTTGACACACCAATCCTCCCACTTATAAGAACACCTTGAACGCCTATGCTTCACCCAAGTATATACTGTCGACTTCACATTGTCAGTCACCTTTGTCGGAGAAACCCGGATCTTTTTAAAAATCCAGTCACAACGTGCTTTCCAAATCAACCAAAGAGTGCCATAACAAATCGCCACTAGATCTCGTTT...

CDS

Download CDS FASTA

1143 bp · TkA06G027470|TK1151|CDS

ATGTCTCTCCTCTTCTCCCACAACCCAACACTCCTCTTCGAGAACTCGGCCACCACCGCCACCACCGCCACCACCACCACAACAGCCACTTCCTCCATGCTCCACTGCTTTGCCCCTAATTCCCTATCTTTCTTAATCCGTCCCAGAAGAATCAAATCGACATTCATTCGGTGTTCCTCAAACAATCCCCCAACCACCCCTGGATGGAACCCCGCTGACCAGACAGTCAACGACGACGAAGAATCCGACAGGTCTCAATC...

Protein

Download Protein FASTA

380 aa · TkA06G027470|TK1151|PROTEIN

MSLLFSHNPTLLFENSATTATTATTTTTATSSMLHCFAPNSLSFLIRPRRIKSTFIRCSSNNPPTTPGWNPADQTVNDDEESDRSQSPTVTDEWGEKSEPELEPLTNLSTSDPPKDEDEWGNGNGATEQPKEEISVAGNGSPAVEATGFEDNGKIEYLKRCLVDTVYGTGLGFRASPEERAEIMELVTQLEGINPTPAPTDAVELLDGNWILLYTAFSELLPLLAVGTTPLLKVDQISQQVSTTNLTIDNSITFSTPFAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G027470`
TK1151 ID	TkA06G027470
OH-1004 ID	LXL04_026103
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G027470

Location Chr06:7427582-7430559 (+)

Description Similar to PAP3: Probable plastid-lipid-associated protein 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35490`	Probably involved in light/cold stress-related jasmonate (JA) biosynthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0575700`	Probable plastid-lipid-associated protein 3, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026103 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009753 response to jasmonic acid Biological Process

GO:0010117 photoprotection Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0010287 plastoglobule Cellular Component

KEGG gene cross-reference

ath:AT2G35490

dosa:Os10g0575700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.989

Rank 1 · TkA06G027470 · TK1151

Cytoplasm0.021

Rank 2 · TkA06G027470 · TK1151

Mitochondrion0.020

Rank 3 · TkA06G027470 · TK1151

Peroxisome0.017

Rank 4 · TkA06G027470 · TK1151

Nucleus0.017

Rank 5 · TkA06G027470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04755PAP_fibrillin158-372 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G027470	`PF04755`	PAP_fibrillin	158	372	1.5e-68	231.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82291`	Arabidopsis thaliana	sp\|O82291\|PAP3_ARATH Probable plastid-lipid-associated protein 3, chloroplastic	56.600%	Swiss-Prot	High
`Q7XBW5`	Oryza sativa subsp. japonica	sp\|Q7XBW5\|PAP3_ORYSJ Probable plastid-lipid-associated protein 3, chloroplastic	52.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card