TkA06G026590 | RubberDandelionOmics

Gene overview

TkA06G026590

Reference: TK1151 Chr: Chr06 Coordinates: 7166384-7167847 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1274 bp · TkA06G026590|TK1151|cDNA

CAGCTTGTATAGAATCCATATATATCTACAACCTCTGATTCAATCTCATAGGGCCTCTCACACCCATACTATCTGCTAGTAAATTTTATATAACAAATTTTGATAAAATGACAGGTGTCCTTTTCCGGACCGGTTCCGGGTCTATTCACTCGTCGCTACAGGCCGGTTCACCGAGGTTCACCGTTCCCCTTCGCCATGATTCGTTCTCCGGGGCTGACAAGGTGGAGTTTTCGTCTTTGTGTTTGGAGGTTAACAAAAGT...

CDS

Download CDS FASTA

867 bp · TkA06G026590|TK1151|CDS

ATGACAGGTGTCCTTTTCCGGACCGGTTCCGGGTCTATTCACTCGTCGCTACAGGCCGGTTCACCGAGGTTCACCGTTCCCCTTCGCCATGATTCGTTCTCCGGGGCTGACAAGGTGGAGTTTTCGTCTTTGTGTTTGGAGGTTAACAAAAGTCGTCGGAGACTCAGCAGAGCTGTATCTGAGCCGCAGGTAATTACTAGACTGAGGTCAATGTCAATCAGTGCTGGATCACAAACCTTTCCGGAAATGTTACCGGAGGT...

Protein

Download Protein FASTA

288 aa · TkA06G026590|TK1151|PROTEIN

MTGVLFRTGSGSIHSSLQAGSPRFTVPLRHDSFSGADKVEFSSLCLEVNKSRRRLSRAVSEPQVITRLRSMSISAGSQTFPEMLPEVEEESLLDGDFIEGIGTFKFAEKCFERMSWMPASGREVEETQFSGGGSGSGRDRDGFGSGKSSGGSNNNEQNRNKIGEYYQQMLKSNPSDPLLLRNYGKFLHEVEGDTVKAEEYYGRAILANPGDGELLSLYGKLIWDTEKDGERAKSYFDQAISASPDDCMVMGSYAQFMWEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G026590`
TK1151 ID	TkA06G026590
OH-1004 ID	LXL04_026132
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G026590`
Location	Chr06:7166384-7167847 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026132` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.450

Rank 1 · TkA06G026590 · TK1151

Nucleus0.429

Rank 2 · TkA06G026590 · TK1151

Cell membrane0.173

Rank 3 · TkA06G026590 · TK1151

Plastid0.090

Rank 4 · TkA06G026590 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA06G026590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00515TPR_1105-113 aa

PF07719TPR_2107-113 aa

PF30153TPR_YpiA_C154-211 aa

PF23914TPR_CcmH_CycH154-180 aa

PF25474TPR_TmcB158-204 aa

PF13428TPR_14164-185 aa

PF14559TPR_19164-221 aa

PF07719TPR_2164-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G026590	`PF00515`	TPR_1	105	113	0.0036	17.8
TkA06G026590	`PF07719`	TPR_2	107	113	0.00053	20.6
TkA06G026590	`PF30153`	TPR_YpiA_C	154	211	0.00012	23.4
TkA06G026590	`PF23914`	TPR_CcmH_CycH	154	180	0.0075	16.8
TkA06G026590	`PF25474`	TPR_TmcB	158	204	1.3e-10	42.0
TkA06G026590	`PF13428`	TPR_14	164	185	1.8e-06	28.8
TkA06G026590	`PF14559`	TPR_19	164	221	2.4e-05	25.3
TkA06G026590	`PF07719`	TPR_2	164	176	0.00053	20.6
TkA06G026590	`PF13181`	TPR_8	164	175	0.0026	18.5
TkA06G026590	`PF00515`	TPR_1	164	176	0.0036	17.8
TkA06G026590	`PF13432`	TPR_16	164	210	0.0064	17.6
TkA06G026590	`PF13429`	TPR_15	164	184	0.024	14.8
TkA06G026590	`PF29386`	CFAP70_mid_TPR	164	247	0.042	14.8
TkA06G026590	`PF13431`	TPR_17	165	198	1e-05	26.1
TkA06G026590	`PF25062`	ARM_TT21_N	184	257	0.00084	19.8
TkA06G026590	`PF13428`	TPR_14	187	221	1.8e-06	28.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card