TkA06G022490 | RubberDandelionOmics

Gene overview

TkA06G022490

Reference: TK1151 Chr: Chr06 Coordinates: 6193651-6196370 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1661 bp · TkA06G022490|TK1151|cDNA

GTTCGTTGATATCGACCACAACTAATTCAAGAGCTTTTGGGAAAGATAACGTCGTCGTTTTGTGTATGTCACCTGACACTGATACCTACATATAGTCATATAGATACAGATGAACGAAGAGGCGCCATACAATTTGCATTCCTGGAAAGAGCTCATAGAAGTGCCGTGGTAAACCCTAATCTCAGCTTAAATGGCATCTCTAATGTTGCCATCTCCATCTTCATGCTCCACTTCTTCTTCTTCGTCGCCATTATCTCGGT...

CDS

Download CDS FASTA

1188 bp · TkA06G022490|TK1151|CDS

ATGGCATCTCTAATGTTGCCATCTCCATCTTCATGCTCCACTTCTTCTTCTTCGTCGCCATTATCTCGGTGCCCTTTAAGCCGTGGTCTTAGCTACAGCAACGCCCGTATTCCTGCTTCTGCTAGCAACATCAGATGCGAAGTTAGCAAATCATTGAACGGGAAACCATGTGTACCAATCATCAACGATAGAATGCTATCAAACATCATGCAACCACCTGGGCGCCTGAATCATCCTGTCATGAATGGAAAACTCAAAAT...

Protein

Download Protein FASTA

395 aa · TkA06G022490|TK1151|PROTEIN

MASLMLPSPSSCSTSSSSSPLSRCPLSRGLSYSNARIPASASNIRCEVSKSLNGKPCVPIINDRMLSNIMQPPGRLNHPVMNGKLKIFSGTANSALSEEIARYMGLDLGRIEIKRFADGEIYVQLQESVRGCDVYLVQPTSPPANENLMELLVTIDACRRASAKNITAVIPYFGYARADRKTQGRESIAAKLVANLITEAGADRVLACDLHSGQSMGYFDIPVDHVYCQPVILDYLASKSICSNDLVVVSPDVGGVARAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G022490`
TK1151 ID	TkA06G022490
OH-1004 ID	LXL04_026184
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G022490

Location Chr06:6193651-6196370 (+)

Description Similar to PRS1: Ribose-phosphate pyrophosphokinase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32380`	Ribose-phosphate pyrophosphokinase 2, chloroplastic.	No verified direct reference in this release
`At2g35390`	Ribose-phosphate pyrophosphokinase 1, chloroplastic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0127700`	Ribose-phosphate pyrophosphokinase 1, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026184 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006015 5-phosphoribose 1-diphosphate biosynthetic process Biological Process

GO:0006164 purine nucleotide biosynthetic process Biological Process

GO:0009156 ribonucleoside monophosphate biosynthetic process Biological Process

GO:0002189 ribose phosphate diphosphokinase complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004749 ribose phosphate diphosphokinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016301 kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G32380

ath:AT2G35390

dosa:Os02g0127700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.967

Rank 1 · TkA06G022490 · TK1151

Mitochondrion0.052

Rank 2 · TkA06G022490 · TK1151

Cytoplasm0.024

Rank 3 · TkA06G022490 · TK1151

Nucleus0.021

Rank 4 · TkA06G022490 · TK1151

Peroxisome0.018

Rank 5 · TkA06G022490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13793Pribosyltran_N85-201 aa

PF01106NifU94-133 aa

PF26420Halo_prof107-156 aa

PF14681UPRTase119-140 aa

PF00156Pribosyltran244-332 aa

PF14572Pribosyl_synth246-268 aa

PF14681UPRTase273-357 aa

PF14572Pribosyl_synth286-394 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G022490	`PF13793`	Pribosyltran_N	85	201	4.5e-51	172.4
TkA06G022490	`PF01106`	NifU	94	133	0.027	15.3
TkA06G022490	`PF26420`	Halo_prof	107	156	0.34	11.8
TkA06G022490	`PF14681`	UPRTase	119	140	0.0099	16.1
TkA06G022490	`PF00156`	Pribosyltran	244	332	1.2e-16	61.1
TkA06G022490	`PF14572`	Pribosyl_synth	246	268	1.7e-25	90.8
TkA06G022490	`PF14681`	UPRTase	273	357	0.0099	16.1
TkA06G022490	`PF14572`	Pribosyl_synth	286	394	1.7e-25	90.8
TkA06G022490	`PF26420`	Halo_prof	320	334	0.34	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42583`	Arabidopsis thaliana	sp\|Q42583\|KPRS2_ARATH Ribose-phosphate pyrophosphokinase 2, chloroplastic	77.600%	Swiss-Prot	High
`Q42581`	Arabidopsis thaliana	sp\|Q42581\|KPRS1_ARATH Ribose-phosphate pyrophosphokinase 1, chloroplastic	81.500%	Swiss-Prot	High
`Q6Z2L5`	Oryza sativa subsp. japonica	sp\|Q6Z2L5\|KPRS1_ORYSJ Ribose-phosphate pyrophosphokinase 1, chloroplastic	75.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card