TkA06G021680 | RubberDandelionOmics

Gene overview

TkA06G021680

Reference: TK1151 Chr: Chr06 Coordinates: 5974906-5976120 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

930 bp · TkA06G021680|TK1151|cDNA

TTAACTAAACATTCAACTTCTCTTCACTTTGCCGTGGTTTACACACCACTCTCACCAACTCCTCTTTATAACCCCAACATTTCCTCCCCCTTCCCCTTTCTCTCCGCCCACCGCCACCACCGCACAAAAATGGACTCTGCCACCACAACAAAACAATGCCATCTTCAACACAACGACGGTCTCGCGTCGATCACCGCCGTGCAACGTGGATTCTCGTCGTCGTCACGGCCTCTTCATTCCACCGGAACAACAGGCTTTAG...

CDS

Download CDS FASTA

582 bp · TkA06G021680|TK1151|CDS

TTAACTAAACATTCAACTTCTCTTCACTTTGCCGTGGTTTACACACCACTCTCACCAACTCCTCTTTATAACCCCAACATTTCCTCCCCCTTCCCCTTTCTCTCCGCCCACCGCCACCACCGCACAAAAATGGACTCTGCCACCACAACAAAACAATGCCATCTTCAACACAACGACGGTCTCGCGTCGATCACCGCCGTGCAACGTGGATTCTCGTCGTCGTCACGGCCTCTTCATTCCACCGGAACAACAGGCTTTAG...

Protein

Download Protein FASTA

193 aa · TkA06G021680|TK1151|PROTEIN

LTKHSTSLHFAVVYTPLSPTPLYNPNISSPFPFLSAHRHHRTKMDSATTTKQCHLQHNDGLASITAVQRGFSSSSRPLHSTGTTGFRSLCSFSSSRSGTFLNGRFQEQQPHFLDACFLCKKPLGCNRDIFMYRGDLPFCSEECRAEQIEIDEEKEKKRSLFSSIKAMRKKEENEKTSKSSPKYPFHSGTVAAA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G021680`
TK1151 ID	TkA06G021680
OH-1004 ID	LXL04_029692
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.100
Protein coverage (%)	TK1151 77.720 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G021680

Location Chr06:5974906-5976120 (-)

Description Similar to FLZ2: FCS-Like Zinc finger 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47060`	May act as an adapter to facilitate the interaction of SnRK1 complex with effector proteins, conferring tissue- and stimulus-type specific differences in the SnRK1 regulation pathway.	No verified direct reference in this release
`At4g17670`	May act as an adapter to facilitate the interaction of SnRK1 complex with effector proteins, conferring tissue- and stimulus-type specific differences in the SnRK1 regulation pathway.	No verified direct reference in this release
`At2g44670`	May act as an adapter to facilitate the interaction of SnRK1 complex with effector proteins, conferring tissue- and stimulus-type specific differences in the SnRK1 regulation pathway.	No verified direct reference in this release
`At1g53885`	May act as an adapter to facilitate the interaction of SnRK1 complex with effector proteins, conferring tissue- and stimulus-type specific differences in the SnRK1 regulation pathway.	No verified direct reference in this release
`At1g53903`	May act as an adapter to facilitate the interaction of SnRK1 complex with effector proteins, conferring tissue- and stimulus-type specific differences in the SnRK1 regulation pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029692 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009646 response to absence of light Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0042594 response to starvation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0090351 seedling development Biological Process

GO:1905582 response to mannose Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G22160

ath:AT1G78020

ath:AT2G44670

ath:AT4G17670

ath:AT5G47060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.662

Rank 1 · TkA06G021680 · TK1151

Cytoplasm0.359

Rank 2 · TkA06G021680 · TK1151

Cell membrane0.083

Rank 3 · TkA06G021680 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkA06G021680 · TK1151

Mitochondrion0.025

Rank 5 · TkA06G021680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12855Ecl127-93 aa

PF04570zf-FLZ104-154 aa

PF12855Ecl1124-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G021680	`PF12855`	Ecl1	27	93	0.054	15.3
TkA06G021680	`PF04570`	zf-FLZ	104	154	1.1e-23	83.1
TkA06G021680	`PF12855`	Ecl1	124	181	0.054	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGQ9`	Arabidopsis thaliana	sp\|Q9FGQ9\|FLZ1_ARATH FCS-Like Zinc finger 1	68.400%	Swiss-Prot	Medium
`Q8VZM9`	Arabidopsis thaliana	sp\|Q8VZM9\|FLZ2_ARATH FCS-Like Zinc finger 2	63.400%	Swiss-Prot	Medium
`O80506`	Arabidopsis thaliana	sp\|O80506\|FLZ3_ARATH FCS-Like Zinc finger 3	45.300%	Swiss-Prot	Low
`P0DO11`	Arabidopsis thaliana	sp\|P0DO11\|FLZ17_ARATH FCS-Like Zinc finger 17	56.800%	Swiss-Prot	Low
`P0DO12`	Arabidopsis thaliana	sp\|P0DO12\|FLZ18_ARATH FCS-Like Zinc finger 18	56.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card