TkA06G021040 | RubberDandelionOmics

Gene overview

TkA06G021040

Reference: TK1151 Chr: Chr06 Coordinates: 5738732-5739166 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

435 bp · TkA06G021040|TK1151|cDNA

ATGGCAGTCATTAATAACCATCAAACCACACCTCCAACCACCGTTTTCTTCCCTTCTTATTCTTACTTTCAGTCTCTAGCCAAAACCCCACAAAGGCTAAGGAAGAGGGTTCTAGCCACATGGACACCAGACCAGGAGATCAACCAAATGAGGCTAAGGTCCGGTGCCGACATGAAGAGAAAACTCACGTGGTATGATCTTATTGCTCTTGGTGTCGGTGGTATGCTTGGTGTTGGAGTTTTCGTGACGACTGGACCCGT...

CDS

Download CDS FASTA

435 bp · TkA06G021040|TK1151|CDS

ATGGCAGTCATTAATAACCATCAAACCACACCTCCAACCACCGTTTTCTTCCCTTCTTATTCTTACTTTCAGTCTCTAGCCAAAACCCCACAAAGGCTAAGGAAGAGGGTTCTAGCCACATGGACACCAGACCAGGAGATCAACCAAATGAGGCTAAGGTCCGGTGCCGACATGAAGAGAAAACTCACGTGGTATGATCTTATTGCTCTTGGTGTCGGTGGTATGCTTGGTGTTGGAGTTTTCGTGACGACTGGACCCGT...

Protein

Download Protein FASTA

144 aa · TkA06G021040|TK1151|PROTEIN

MAVINNHQTTPPTTVFFPSYSYFQSLAKTPQRLRKRVLATWTPDQEINQMRLRSGADMKRKLTWYDLIALGVGGMLGVGVFVTTGPVARDKSGPGVLVSYVIAGISALFSSLCYTEFSIQIPVAGGAFSYLRVTFGMNLMNIYI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G021040`
TK1151 ID	TkA06G021040
OH-1004 ID	LXL04_026216
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 94.444 / OH-1004 22.934 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G021040

Location Chr06:5738732-5739166 (-)

Description Similar to CAT6: Cationic amino acid transporter 6, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04770`	Permease involved in the transport of the cationic neutral or acidic amino acids.	Molecular and functional characterization of a family of amino acid transporters from Arabidopsis.2004 · DOI: 10.1104/pp.104.045278
`At3g10600`	Permease involved in the transport of the cationic amino acids.	No verified direct reference in this release
`At4g21120`	High-affinity permease involved in the transport of the cationic amino acids (e.g. arginine, lysine, histidine, citrulline, valine, and glutamate).	No verified direct reference in this release
`At2g34960`	High-affinity permease involved in the transport of the cationic amino acids (e.g. arginine, and, to a lower extent, citrulline and glutamate).	Molecular and functional characterization of a family of amino acid transporters from Arabidopsis.2004 · DOI: 10.1104/pp.104.045278
`At1g17120`	Permease involved in the transport of the cationic neutral or acidic amino acids.	Molecular and functional characterization of a family of amino acid transporters from Arabidopsis.2004 · DOI: 10.1104/pp.104.045278

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026216 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006865 amino acid transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G17120

ath:AT2G34960

ath:AT3G10600

ath:AT4G21120

ath:AT5G04770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.347

Rank 1 · TkA06G021040 · TK1151

Cell membrane0.283

Rank 2 · TkA06G021040 · TK1151

Endoplasmic reticulum0.186

Rank 3 · TkA06G021040 · TK1151

Cytoplasm0.104

Rank 4 · TkA06G021040 · TK1151

Golgi apparatus0.093

Rank 5 · TkA06G021040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13520AA_permease_262-139 aa

PF12666PrgI62-106 aa

PF00324AA_permease68-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G021040	`PF13520`	AA_permease_2	62	139	1.4e-07	31.5
TkA06G021040	`PF12666`	PrgI	62	106	0.18	13.2
TkA06G021040	`PF00324`	AA_permease	68	131	2.9e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ20`	Arabidopsis thaliana	sp\|Q9LZ20\|CAAT6_ARATH Cationic amino acid transporter 6, chloroplastic	55.700%	Swiss-Prot	High
`Q9SQZ0`	Arabidopsis thaliana	sp\|Q9SQZ0\|CAAT7_ARATH Cationic amino acid transporter 7, chloroplastic	54.800%	Swiss-Prot	High
`Q84MA5`	Arabidopsis thaliana	sp\|Q84MA5\|CAAT1_ARATH Cationic amino acid transporter 1	50.000%	Swiss-Prot	High
`O64759`	Arabidopsis thaliana	sp\|O64759\|CAAT5_ARATH Cationic amino acid transporter 5	41.700%	Swiss-Prot	Medium
`Q9SHH0`	Arabidopsis thaliana	sp\|Q9SHH0\|CAAT8_ARATH Cationic amino acid transporter 8, vacuolar	48.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card