TkA06G020470 | RubberDandelionOmics

Gene overview

TkA06G020470

Reference: TK1151 Chr: Chr06 Coordinates: 5591376-5592921 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1014 bp · TkA06G020470|TK1151|cDNA

TATATCTCCCTTCCCCTATTAAATAGCCACAAGCATCGACCCTTAATCAACACAAACACAACACGGTTTGGAATATATTATATATACAAACACACACGATTGGAACTGAAGGAAGAGATACTTTCTCTAACATTTGAGAATATCTTCTAAACTTGGTTTCCTTTTTCTCTGAGTTCTCTCTCCCATCTCTATTAACTTATATATTTAACTTCATTACATATGGCAAGCCTACGATCCGAGAGCCTATTTGGATCTTTCTT...

CDS

Download CDS FASTA

537 bp · TkA06G020470|TK1151|CDS

ATGGCAAGCCTACGATCCGAGAGCCTATTTGGATCTTTCTTCTCTGCTGTGATCAGATATTGTTTCACCTATCAATCAAGCTACAAAGACCACCTAAGACCCGACATGCCTAAGGGTCGTCGCCCTCTTTCTTTACAGACCATCGAGCTTCAAGTCAGGATGTGTTGCACCGGATGCGAGCGGGTTGTCAAAAGTGCCATCCACAAGCTTAGAGGAGTTGACTCTGTGGAGGTGGAGCTAGAAATGGAGAGGGTGACGGT...

Protein

Download Protein FASTA

178 aa · TkA06G020470|TK1151|PROTEIN

MASLRSESLFGSFFSAVIRYCFTYQSSYKDHLRPDMPKGRRPLSLQTIELQVRMCCTGCERVVKSAIHKLRGVDSVEVELEMERVTVIGYVDRNKVLKAVRRAGKRAEFWPFPNPPLYFTSTSTYFKDMNNDYKESYNYYRHGYNIGDRHGNIPVSQRGDDKVSNMFNDDNVNACCVM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G020470`
TK1151 ID	TkA06G020470
OH-1004 ID	LXL04_024481
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	36.200
Protein coverage (%)	TK1151 79.213 / OH-1004 87.838 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G020470

Location Chr06:5591376-5592921 (-)

Description Similar to HIPP22: Heavy metal-associated isoprenylated plant protein 22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18196`	Heavy-metal-binding protein.	No verified direct reference in this release
`At4g10465`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g56891`	Heavy-metal-binding protein.	No verified direct reference in this release
`At1g06330`	Heavy-metal-binding protein.	No verified direct reference in this release
`At4g38580`	Heavy-metal-binding protein.	Metallochaperone-like genes in Arabidopsis thaliana.2010 · DOI: 10.1039/c003484c

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024481 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010286 heat acclimation Biological Process

GO:0071585 detoxification of cadmium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0032791 lead ion binding Molecular Function

GO:0046870 cadmium ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G22990

ath:AT1G71050

ath:AT4G38580

ath:AT4G39700

ath:AT5G17450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.357

Rank 1 · TkA06G020470 · TK1151

Nucleus0.336

Rank 2 · TkA06G020470 · TK1151

Cytoplasm0.286

Rank 3 · TkA06G020470 · TK1151

Endoplasmic reticulum0.081

Rank 4 · TkA06G020470 · TK1151

Plastid0.080

Rank 5 · TkA06G020470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19803DUF628642-92 aa

PF12156ATPase-cat_bd49-65 aa

PF00403HMA51-105 aa

PF12156ATPase-cat_bd162-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G020470	`PF19803`	DUF6286	42	92	0.0031	18.6
TkA06G020470	`PF12156`	ATPase-cat_bd	49	65	0.033	15.6
TkA06G020470	`PF00403`	HMA	51	105	1.3e-12	48.6
TkA06G020470	`PF12156`	ATPase-cat_bd	162	176	0.033	15.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IQG4`	Arabidopsis thaliana	sp\|F4IQG4\|HIP30_ARATH Heavy metal-associated isoprenylated plant protein 30	69.100%	Swiss-Prot	High
`F4JMB8`	Arabidopsis thaliana	sp\|F4JMB8\|HIP44_ARATH Heavy metal-associated isoprenylated plant protein 44	55.400%	Swiss-Prot	High
`B3H6D0`	Arabidopsis thaliana	sp\|B3H6D0\|HIP45_ARATH Heavy metal-associated isoprenylated plant protein 45	54.700%	Swiss-Prot	Low
`F4IC29`	Arabidopsis thaliana	sp\|F4IC29\|HIP28_ARATH Heavy metal-associated isoprenylated plant protein 28	50.000%	Swiss-Prot	Low
`Q9SZN7`	Arabidopsis thaliana	sp\|Q9SZN7\|HIP26_ARATH Heavy metal-associated isoprenylated plant protein 26	44.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card