Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1904 bp · TkA06G019920|TK1151|cDNA
TTTCATGATATTCGATGCCGGTTGTTTAAAATTCTGATTTCAGCTACATACATCTGATTTCTAATATGTGTTTTCGACCATAATCAAATTCAATTCACGAAATCGAAAATTGGTGGTGTATCTATGTCGTAAGCACGCTTAGAGTGGGATTTTTGTCAATTTTAAGGTGAAATGTATTAAAATTCTAACTTTATTACTGCGATTTGATGATATTTGAAGGTAATTACATCAGCAATTCAGGATACAAAAGCATTGGTGGA...
1320 bp · TkA06G019920|TK1151|CDS
ATGGCATATGGAGGCACACCTGTGGGCCCACCTGCATCTGCAGGAAGTTCTCCTGCAATGAAGCAAGTGAAATTGGAAAAAGAGAGTGAACTAAGAATTGAAGTCAATGTTAACAGTTCTCTTCGCCTTAGGGTACTAAATGGGACAGCTGAAATATTTGGGACCGAAATGCCCCCAGAAAATTGGCTCGTTTTTCCACCAAGAATGAAATTTGCTATATTTACATGGTATGGGGCGACAATTGAAATGCAAGATAACAC...
Protein
Download Protein FASTA439 aa · TkA06G019920|TK1151|PROTEIN
MAYGGTPVGPPASAGSSPAMKQVKLEKESELRIEVNVNSSLRLRVLNGTAEIFGTEMPPENWLVFPPRMKFAIFTWYGATIEMQDNTETDYVADETPMISYVNVHAVLEGRRNRAKASPSDSDASQGPRVIVVGPTDSGKSTLSRMLLSWAAKQGWKPTFVDLDIGQGSITLSGCIAATPIEMPIDPVEGIPLEMPLVYFFGHNTPTVNADLYRVLVKELAQILERQFTGNAESRAAGMVINTMGFIDGLGYDLLLHAID...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G019920 |
|---|---|
| TK1151 ID | TkA06G019920 |
| OH-1004 ID | LXL04_031386 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 25.400 |
| Protein coverage (%) | TK1151 32.118 / OH-1004 37.166Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G019920 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:5436017-5441948 (-) | |||||||||
| Description | Similar to At5g11010: Polynucleotide 5'-hydroxyl-kinase NOL9 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000460 maturation of 5.8S rRNA Biological Process GO:0006364 rRNA processing Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0016020 membrane Cellular Component GO:0045111 intermediate filament cytoskeleton Cellular Component GO:0120330 rixosome complex Cellular Component GO:0003723 RNA binding Molecular Function GO:0005524 ATP binding Molecular Function GO:0046404 ATP-dependent polydeoxyribonucleotide 5'-hydroxyl-kinase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT5G11010 bta:523474 dre:567715 hsa:79707 mmu:74035 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16573CLP1_N24-115 aaPF01580FtsK_SpoIIIE119-153 aaPF00005ABC_tran123-149 aaPF07755DUF1611124-171 aaPF13191AAA_16124-154 aaPF09439SRPRB126-150 aaPF13555AAA_29126-143 aaPF20720nSTAND3130-161 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G019920 | PF16573 | CLP1_N | 24 | 115 | 6.6e-32 | 110.2 |
| TkA06G019920 | PF01580 | FtsK_SpoIIIE | 119 | 153 | 0.046 | 13.9 |
| TkA06G019920 | PF00005 | ABC_tran | 123 | 149 | 0.16 | 13.3 |
| TkA06G019920 | PF07755 | DUF1611 | 124 | 171 | 0.18 | 11.9 |
| TkA06G019920 | PF13191 | AAA_16 | 124 | 154 | 0.29 | 12.4 |
| TkA06G019920 | PF09439 | SRPRB | 126 | 150 | 0.2 | 11.7 |
| TkA06G019920 | PF13555 | AAA_29 | 126 | 143 | 0.23 | 12.0 |
| TkA06G019920 | PF20720 | nSTAND3 | 130 | 161 | 0.00024 | 21.5 |
| TkA06G019920 | PF13401 | AAA_22 | 130 | 177 | 0.026 | 15.5 |
| TkA06G019920 | PF01656 | CbiA | 131 | 216 | 0.003 | 18.2 |
| TkA06G019920 | PF03029 | ATP_bind_1 | 132 | 166 | 0.16 | 12.4 |
| TkA06G019920 | PF16575 | CLP1_P | 134 | 322 | 1.8e-69 | 234.0 |
| TkA06G019920 | PF13191 | AAA_16 | 215 | 287 | 0.29 | 12.4 |
| TkA06G019920 | PF06807 | Clp1 | 327 | 438 | 3.9e-32 | 111.8 |
| TkA06G019920 | PF09439 | SRPRB | 393 | 418 | 0.2 | 11.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.