TkA06G017870 | RubberDandelionOmics

Gene overview

TkA06G017870

Reference: TK1151 Chr: Chr06 Coordinates: 4879139-4880829 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1608 bp · TkA06G017870|TK1151|cDNA

AAAAATCACTATAAAAACAGCCCTTCCATCCTCATTCTTCTTCATCTCTTTCCTGCTCTTGTTTTAATCCCATTACTACAAATTTACCATCAATGGCAGCCATTCAGAACACCCACTTTTCCACCTCCTCAAAGAAGAGAATGACTCCCGGTGACTTTACCAGGGACGACGATATCATCACCAAAAAAACATTTGAAGACCCTGCATCAGCTTTGGCTAATGCTCGACATGAATTCGGCGAACATGGCGGCGTTAACATG...

CDS

Download CDS FASTA

1311 bp · TkA06G017870|TK1151|CDS

ATGGCAGCCATTCAGAACACCCACTTTTCCACCTCCTCAAAGAAGAGAATGACTCCCGGTGACTTTACCAGGGACGACGATATCATCACCAAAAAAACATTTGAAGACCCTGCATCAGCTTTGGCTAATGCTCGACATGAATTCGGCGAACATGGCGGCGTTAACATGTCAATCGAGGCTTCCGCCACCTTCACCGTCATGGAACCAGAAACCCTCAGCCGCATGTTCACCGGCGAGCTAGGTCCCGATCGTGATTTCTT...

Protein

Download Protein FASTA

436 aa · TkA06G017870|TK1151|PROTEIN

MAAIQNTHFSTSSKKRMTPGDFTRDDDIITKKTFEDPASALANARHEFGEHGGVNMSIEASATFTVMEPETLSRMFTGELGPDRDFFIYSRHFNPTVLALGRQMAAMEGTEAAYCTSSGMAAISSVLLQLVSSGEHIVASPTLYGGTHAFLTHFLPKSSNIKTTFVDIRDLKKVEEAIVEGHTKVFFFESISNPTLTVANIPELSRIAHEKGVTVVVDNTFAPMVVSPAKLGADVVVHSISKYISGGADIIAGAVCGPAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G017870`
TK1151 ID	TkA06G017870
OH-1004 ID	LXL04_026252
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 99.771 / OH-1004 88.957 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G017870

Location Chr06:4879139-4880829 (+)

Description Similar to MGL: Methionine gamma-lyase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64660`	Catalyzes the degradation of L-methionine to alpha- ketobutyrate, methanethiol and ammonia.	Functional characterization of a methionine gamma-lyase in Arabidopsis and its implication in an alternative to the reverse trans-sulfuration pathway.2007 · DOI: 10.1093/pcp/pcl055

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026252 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009086 methionine biosynthetic process Biological Process

GO:0009970 cellular response to sulfate starvation Biological Process

GO:0019346 transsulfuration Biological Process

GO:0019458 L-methionine catabolic process via 2-oxobutanoate Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0046677 response to antibiotic Biological Process

GO:0051289 protein homotetramerization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016846 carbon-sulfur lyase activity Molecular Function

GO:0018826 methionine gamma-lyase activity Molecular Function

GO:0030170 pyridoxal phosphate binding Molecular Function

KEGG gene cross-reference

ath:AT1G64660

fnu:FN1419

fpol:ERS445057_02025

pgi:PG_0343

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.586

Rank 1 · TkA06G017870 · TK1151

Nucleus0.251

Rank 2 · TkA06G017870 · TK1151

Mitochondrion0.212

Rank 3 · TkA06G017870 · TK1151

Peroxisome0.103

Rank 4 · TkA06G017870 · TK1151

Plastid0.068

Rank 5 · TkA06G017870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01053Cys_Met_Meta_PP49-417 aa

PF01212Beta_elim_lyase94-219 aa

PF01041DegT_DnrJ_EryC195-219 aa

PF00155Aminotran_1_2107-288 aa

PF00266Aminotran_5119-284 aa

PF06838Met_gamma_lyase192-263 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G017870	`PF01053`	Cys_Met_Meta_PP	49	417	2.3e-84	283.9
TkA06G017870	`PF01212`	Beta_elim_lyase	94	219	0.0074	16.4
TkA06G017870	`PF01041`	DegT_DnrJ_EryC1	95	219	0.044	13.7
TkA06G017870	`PF00155`	Aminotran_1_2	107	288	8.3e-11	42.4
TkA06G017870	`PF00266`	Aminotran_5	119	284	1.8e-08	34.5
TkA06G017870	`PF06838`	Met_gamma_lyase	192	263	0.01	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGU9`	Arabidopsis thaliana	sp\|Q9SGU9\|MGL_ARATH Methionine gamma-lyase	73.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card