TkA06G017860 | RubberDandelionOmics

Gene overview

TkA06G017860

Reference: TK1151 Chr: Chr06 Coordinates: 4876172-4885080 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2301 bp · TkA06G017860|TK1151|cDNA

ATGGAGCACCTCGCCAAGATGGATATTATTCAAAAATCGAGAAATAAGTGGATCAGGGATGGGGACGAAAACTCGAAATACTTTCACAGTTCCTTGAAAATCAAAAACCGAAGATCTAACATTCACGGGATTATGGTCAACGGGAGATGGATAAATGATGTCAACGGAATAAAGCAAGAAACATGGAATTTTTTTCATGAAAAATTCCACGAAGACAGGAAGGACCGACCCAAAATCATAAATCAAAACTTTAAAACTCT...

CDS

Download CDS FASTA

2301 bp · TkA06G017860|TK1151|CDS

ATGGAGCACCTCGCCAAGATGGATATTATTCAAAAATCGAGAAATAAGTGGATCAGGGATGGGGACGAAAACTCGAAATACTTTCACAGTTCCTTGAAAATCAAAAACCGAAGATCTAACATTCACGGGATTATGGTCAACGGGAGATGGATAAATGATGTCAACGGAATAAAGCAAGAAACATGGAATTTTTTTCATGAAAAATTCCACGAAGACAGGAAGGACCGACCCAAAATCATAAATCAAAACTTTAAAACTCT...

Protein

Download Protein FASTA

766 aa · TkA06G017860|TK1151|PROTEIN

MEHLAKMDIIQKSRNKWIRDGDENSKYFHSSLKIKNRRSNIHGIMVNGRWINDVNGIKQETWNFFHEKFHEDRKDRPKIINQNFKTLSEENKSFLERPFELNEVKDAVWNCGSEKAPGPDGFNFYFIKHYWAFLQDDSLIGCMYKILAKVLASRIKNVIGSVVGESQTAFIKGRNILDEPFIINEVCNWAKKTKRKMFLFKVDFEKAFDCVNWDYLESILGQMNFGRKWISWIRGCLSSSRALVLINGSATKEFNISKGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G017860`
TK1151 ID	TkA06G017860
OH-1004 ID	LXL04_014455
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	40.200
Protein coverage (%)	TK1151 99.478 / OH-1004 43.719 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G017860`
Location	Chr06:4876172-4885080 (-)
Description	Similar to Os01g0810000: Probable U3 small nucleolar RNA-associated protein 11
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014455` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006364 rRNA processing Biological Process GO:0009561 megagametogenesis Biological Process GO:0032197 retrotransposition Biological Process GO:0090304 nucleic acid metabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0003723 RNA binding Molecular Function GO:0003824 catalytic activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function
KEGG gene cross-reference	ath:AT3G60360 dosa:Os01g0810000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.505

Rank 1 · TkA06G017860 · TK1151

Nucleus0.394

Rank 2 · TkA06G017860 · TK1151

Cell membrane0.136

Rank 3 · TkA06G017860 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA06G017860 · TK1151

Lysosome / Vacuole0.036

Rank 5 · TkA06G017860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23448CAP-like_CFAP1848-83 aa

PF00078RVT_1138-295 aa

PF25641Head_fiber_dimeric240-259 aa

PF13966zf-RVT379-401 aa

PF13966zf-RVT461-484 aa

PF13966zf-RVT595-662 aa

PF13966zf-RVT668-697 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G017860	`PF23448`	CAP-like_CFAP184	8	83	0.046	14.6
TkA06G017860	`PF00078`	RVT_1	138	295	3.6e-13	50.5
TkA06G017860	`PF25641`	Head_fiber_dimeric	240	259	0.3	11.6
TkA06G017860	`PF13966`	zf-RVT	379	401	2.7e-15	57.5
TkA06G017860	`PF13966`	zf-RVT	461	484	2.7e-15	57.5
TkA06G017860	`PF13966`	zf-RVT	595	662	2.7e-15	57.5
TkA06G017860	`PF13966`	zf-RVT	668	697	2.7e-15	57.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card