TkA06G017680 | RubberDandelionOmics

Gene overview

TkA06G017680

Reference: TK1151 Chr: Chr06 Coordinates: 4822595-4824560 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1490 bp · TkA06G017680|TK1151|cDNA

CTCCGTAGAAATCACAATCGTCTGGCAGTGGGCTCTATAGACCCGTATAATGATAAGTCGAGTGACCTCTGTTGCTACCATGGTCACAAGATTTCTCGGACTCCTCCAATAATGGCGATAGTAGCTCCAAATTTCAACCGGTCACTATTCGCCACCCCTCTAACGCTAAGCCAGTCGCGCGTTAGAATCCCGGCCACCATGGCGACCCCCGTCGCCAGTACAGGATCCACAGCGGATCAATTCAAAGACCACCACCCGTC...

CDS

Download CDS FASTA

1359 bp · TkA06G017680|TK1151|CDS

CTCCGTAGAAATCACAATCGTCTGGCAGTGGGCTCTATAGACCCGTATAATGATAAGTCGAGTGACCTCTGTTGCTACCATGGTCACAAGATTTCTCGGACTCCTCCAATAATGGCGATAGTAGCTCCAAATTTCAACCGGTCACTATTCGCCACCCCTCTAACGCTAAGCCAGTCGCGCGTTAGAATCCCGGCCACCATGGCGACCCCCGTCGCCAGTACAGGATCCACAGCGGATCAATTCAAAGACCACCACCCGTC...

Protein

Download Protein FASTA

452 aa · TkA06G017680|TK1151|PROTEIN

LRRNHNRLAVGSIDPYNDKSSDLCCYHGHKISRTPPIMAIVAPNFNRSLFATPLTLSQSRVRIPATMATPVASTGSTADQFKDHHPSLEVLGGARDSFCPIIKTHLDRPYNPFPVFGSNRHIETIFAAFFREIPDVRLKRECLRTKDDGTVTLDWVSGDARSLPENSPILLLLPGLSGGSQDAYVRHMLIRARNRGWRVVVFNSRGCADSPVTTPQMYSASFLGDLDEVVGHVTTRYPKANLYGTGWSMGANILVQYLGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G017680`
TK1151 ID	TkA06G017680
OH-1004 ID	LXL04_026255
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 98.451 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G017680`
Location	Chr06:4822595-4824560 (+)
Description	Similar to EMB8: Embryogenesis-associated protein EMB8
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026255` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006656 phosphatidylcholine biosynthetic process Biological Process GO:0046470 phosphatidylcholine metabolic process Biological Process GO:0051792 medium-chain fatty acid biosynthetic process Biological Process GO:0051793 medium-chain fatty acid catabolic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0004623 A2-type glycerophospholipase activity Molecular Function GO:0008126 acetylesterase activity Molecular Function GO:0008970 glycerophospholipid phospholipase A1 activity Molecular Function GO:0034338 short-chain carboxylesterase activity Molecular Function GO:0047372 monoacylglycerol lipase activity Molecular Function
KEGG gene cross-reference	bta:539795 hsa:171586 mmu:106861 rno:313917 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.476

Rank 1 · TkA06G017680 · TK1151

Mitochondrion0.243

Rank 2 · TkA06G017680 · TK1151

Cytoplasm0.106

Rank 3 · TkA06G017680 · TK1151

Endoplasmic reticulum0.088

Rank 4 · TkA06G017680 · TK1151

Cell membrane0.056

Rank 5 · TkA06G017680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20408Abhydrolase_1180-99 aa

PF00561Abhydrolase_1168-406 aa

PF12697Abhydrolase_6170-408 aa

PF20408Abhydrolase_11182-278 aa

PF12146Hydrolase_4193-383 aa

PF04586Peptidase_S78292-357 aa

PF20408Abhydrolase_11341-404 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G017680	`PF20408`	Abhydrolase_11	80	99	0.052	14.0
TkA06G017680	`PF00561`	Abhydrolase_1	168	406	6.3e-15	56.2
TkA06G017680	`PF12697`	Abhydrolase_6	170	408	2.4e-08	35.6
TkA06G017680	`PF20408`	Abhydrolase_11	182	278	0.052	14.0
TkA06G017680	`PF12146`	Hydrolase_4	193	383	1.1e-08	35.4
TkA06G017680	`PF04586`	Peptidase_S78	292	357	0.21	12.4
TkA06G017680	`PF20408`	Abhydrolase_11	341	404	0.052	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card