TkA06G016390 | RubberDandelionOmics

Gene overview

TkA06G016390

Reference: TK1151 Chr: Chr06 Coordinates: 4436791-4437866 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

949 bp · TkA06G016390|TK1151|cDNA

ATAATACACACCACATTCTTCTCTGTTGAAAAACATATACTCGAGAGTGTTTTTGTGTGTGAAACGCCATGGGAAGAGCACCATGTTGTTCAAAGGTGGGTTTACACAGAGGAGCATGGTCGACTGAAGAAGATAAACTCCTCACGGAGTACATTCAAACCAACGGCGAAGGTCAATGGCGTTCTTTACCTTCAAAAGCTGGTTTACTTAGATGCGGAAAGAGTTGCAGGTTGAGATGGATGAATTATCTCCGGCCTGGT...

CDS

Download CDS FASTA

759 bp · TkA06G016390|TK1151|CDS

ATGGGAAGAGCACCATGTTGTTCAAAGGTGGGTTTACACAGAGGAGCATGGTCGACTGAAGAAGATAAACTCCTCACGGAGTACATTCAAACCAACGGCGAAGGTCAATGGCGTTCTTTACCTTCAAAAGCTGGTTTACTTAGATGCGGAAAGAGTTGCAGGTTGAGATGGATGAATTATCTCCGGCCTGGTATCAAGCGAGGAAACTTCACCCCCGATGAGGATGAGCTTATAATTAAGCTTCATTCTATCCATGGCAA...

Protein

Download Protein FASTA

252 aa · TkA06G016390|TK1151|PROTEIN

MGRAPCCSKVGLHRGAWSTEEDKLLTEYIQTNGEGQWRSLPSKAGLLRCGKSCRLRWMNYLRPGIKRGNFTPDEDELIIKLHSIHGNRWSFIATELAGRTDNEVKNHWNSHLKRKALDGGENDVDDSKNKKRRRNKKKADQKSKKVKIMEKPEEIITVPVPEPTSSSSSFPLLQSASSSSITYEGDGDLLADMDFSWAPLLEMDGGARMDGHDDLDIRFDGFDFLALEDEESNMLEKLYDECLHLLQDVEGV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G016390`
TK1151 ID	TkA06G016390
OH-1004 ID	LXL04_026288
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G016390

Location Chr06:4436791-4437866 (-)

Description Similar to MYB111: Transcription factor MYB111

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49330`	Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis.	Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling.2007 · DOI: 10.1111/j.1365-313x.2007.03078.x The Arabidopsis bZIP transcription factor HY5 regulates expression of the PFG1/MYB12 gene in response to light and ultraviolet-B radiation.2010 · DOI: 10.1111/j.1365-3040.2009.02061.x Analysis of PRODUCTION OF FLAVONOL GLYCOSIDES-dependent flavonol glycoside accumulation in Arabidopsis thaliana plants reveals MYB11-, MYB12- and MYB111-independent flavonol glycoside accumulation.2010 · DOI: 10.1111/j.1469-8137.2010.03421.x
`At2g47460`	Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis.	The Arabidopsis transcription factor MYB12 is a flavonol-specific regulator of phenylpropanoid biosynthesis.2005 · DOI: 10.1104/pp.104.058032 Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling.2007 · DOI: 10.1111/j.1365-313x.2007.03078.x The Arabidopsis bZIP transcription factor HY5 regulates expression of the PFG1/MYB12 gene in response to light and ultraviolet-B radiation.2010 · DOI: 10.1111/j.1365-3040.2009.02061.x Analysis of PRODUCTION OF FLAVONOL GLYCOSIDES-dependent flavonol glycoside accumulation in Arabidopsis thaliana plants reveals MYB11-, MYB12- and MYB111-independent flavonol glycoside accumulation.2010 · DOI: 10.1111/j.1469-8137.2010.03421.x
`At1g22640`	Transcription factor MYB3.	No verified direct reference in this release
`At2g16720`	Transcription factor involved in the negative regulation of flavonol biosynthesis.	AtMYB7, a new player in the regulation of UV-sunscreens in Arabidopsis thaliana.2014 · DOI: 10.1093/pcp/pct187 AtMyb7, a subgroup 4 R2R3 Myb, negatively regulates ABA-induced inhibition of seed germination by blocking the expression of the bZIP transcription factor ABI5.2015 · DOI: 10.1111/pce.12415
`At4g09460`	Transcription repressor MYB6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026288 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009800 cinnamic acid biosynthetic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009892 negative regulation of metabolic process Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0051555 flavonol biosynthetic process Biological Process

GO:1900384 regulation of flavonol biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G22640

ath:AT2G16720

ath:AT5G49330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · TkA06G016390 · TK1151

Cytoplasm0.120

Rank 2 · TkA06G016390 · TK1151

Cell membrane0.018

Rank 3 · TkA06G016390 · TK1151

Mitochondrion0.013

Rank 4 · TkA06G016390 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA06G016390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding14-61 aa

PF23082Myb_DNA-binding_216-35 aa

PF13921Myb_DNA-bind_617-75 aa

PF00249Myb_DNA-binding67-112 aa

PF13921Myb_DNA-bind_670-115 aa

PF23082Myb_DNA-binding_287-119 aa

PF27161HI_0983102-165 aa

PF23082Myb_DNA-binding_2128-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G016390	`PF00249`	Myb_DNA-binding	14	61	1.1e-35	122.1
TkA06G016390	`PF23082`	Myb_DNA-binding_2	16	35	2.0	9.3
TkA06G016390	`PF13921`	Myb_DNA-bind_6	17	75	8.1e-20	71.5
TkA06G016390	`PF00249`	Myb_DNA-binding	67	112	1.1e-35	122.1
TkA06G016390	`PF13921`	Myb_DNA-bind_6	70	115	8.1e-20	71.5
TkA06G016390	`PF23082`	Myb_DNA-binding_2	87	119	2.0	9.3
TkA06G016390	`PF27161`	HI_0983	102	165	0.14	12.7
TkA06G016390	`PF23082`	Myb_DNA-binding_2	128	144	2.0	9.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ07`	Arabidopsis thaliana	sp\|Q9FJ07\|MY111_ARATH Transcription factor MYB111	75.700%	Swiss-Prot	Low
`O22264`	Arabidopsis thaliana	sp\|O22264\|MYB12_ARATH Transcription factor MYB12	71.300%	Swiss-Prot	Low
`Q9S9K9`	Arabidopsis thaliana	sp\|Q9S9K9\|MYB3_ARATH Transcription factor MYB3	69.200%	Swiss-Prot	Low
`Q42379`	Arabidopsis thaliana	sp\|Q42379\|MYB7_ARATH Transcription factor MYB7	69.200%	Swiss-Prot	Low
`Q38851`	Arabidopsis thaliana	sp\|Q38851\|MYB6_ARATH Transcription repressor MYB6	67.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card