TkA06G015890 | RubberDandelionOmics

Gene overview

TkA06G015890

Reference: TK1151 Chr: Chr06 Coordinates: 4290585-4292405 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

909 bp · TkA06G015890|TK1151|cDNA

ATGTGGATATGCTGTTGCTGTTCAGCAGTTTTTTTGGGCTATAAGTGGTTCTCTGTCAAAAAAGTCAATGACCATGAGGACCGATTTGAGAAATTTTTTAGGCTGCAAGGTCAGCTTCGGAATTCTGTTTTGTTTCGAGGCAATGAGGGGCTCAAGCTGTATATTCTGTACATTCGGGTGTTTAGCAATTGGGTCAGAAAAATAAAAAAAATGAGCATCCAAGGGTATAATCGGAAACATGAAGCTACCAGGGGCTGTTT...

CDS

Download CDS FASTA

909 bp · TkA06G015890|TK1151|CDS

ATGTGGATATGCTGTTGCTGTTCAGCAGTTTTTTTGGGCTATAAGTGGTTCTCTGTCAAAAAAGTCAATGACCATGAGGACCGATTTGAGAAATTTTTTAGGCTGCAAGGTCAGCTTCGGAATTCTGTTTTGTTTCGAGGCAATGAGGGGCTCAAGCTGTATATTCTGTACATTCGGGTGTTTAGCAATTGGGTCAGAAAAATAAAAAAAATGAGCATCCAAGGGTATAATCGGAAACATGAAGCTACCAGGGGCTGTTT...

Protein

Download Protein FASTA

302 aa · TkA06G015890|TK1151|PROTEIN

MWICCCCSAVFLGYKWFSVKKVNDHEDRFEKFFRLQGQLRNSVLFRGNEGLKLYILYIRVFSNWVRKIKKMSIQGYNRKHEATRGCLGNLLLLLFRKWAKMIRHVMLIFRSQVMGLLWRSWTNCYQGQFWNYGTLWEWSGYRLQRITRRWWYLIGQKSHSYLLLLMIKRHVRRLKLLTFLLTAMEFRFNCHLIHLQQNIFIEYIMLDGVNDEEQHAHQLGRLLDTFEVVSPKHVEFGFAIAFLQSWDLFCTAFCAALPYR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G015890`
TK1151 ID	TkA06G015890
OH-1004 ID	LXL04_021018
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 69.536 / OH-1004 59.490 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G015890

Location Chr06:4290585-4292405 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g57870`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At1g09840`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0547900`	Probable serine-threonine kinase that may regulate brassinosteroid signaling.	No verified direct reference in this release
`Os05g0207500`	Serine-threonine kinase that acts as a negative regulator of brassinosteroid (BR) signaling.	DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice.2012 · DOI: 10.1105/tpc.112.097394 OVATE Family Protein 8 Positively Mediates Brassinosteroid Signaling through Interacting with the GSK3-like Kinase in Rice.2016 · DOI: 10.1371/journal.pgen.1006118 OsBZR1 turnover mediated by OsSK22-regulated U-box E3 ligase OsPUB24 in rice BR response.2019 · DOI: 10.1111/tpj.14332
`Os01g0205700`	Probable serine-threonine kinase that may act as a negative regulator of brassinosteroid (BR) signaling during flower development.	T-DNA tagged knockout mutation of rice OsGSK1, an orthologue of Arabidopsis BIN2, with enhanced tolerance to various abiotic stresses.2007 · DOI: 10.1007/s11103-007-9213-4

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021018 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.371

Rank 1 · TkA06G015890 · TK1151

Nucleus0.317

Rank 2 · TkA06G015890 · TK1151

Mitochondrion0.228

Rank 3 · TkA06G015890 · TK1151

Cell membrane0.087

Rank 4 · TkA06G015890 · TK1151

Endoplasmic reticulum0.081

Rank 5 · TkA06G015890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase265-299 aa

PF07714PK_Tyr_Ser-Thr267-298 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G015890	`PF00069`	Pkinase	265	299	2.2e-05	24.7
TkA06G015890	`PF07714`	PK_Tyr_Ser-Thr	267	298	0.17	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVS6`	Arabidopsis thaliana	sp\|Q9FVS6\|KSG4_ARATH Shaggy-related protein kinase delta	82.500%	Swiss-Prot	Low
`Q39019`	Arabidopsis thaliana	sp\|Q39019\|KSG10_ARATH Shaggy-related protein kinase kappa	80.000%	Swiss-Prot	Low
`Q5Z7J0`	Oryza sativa subsp. japonica	sp\|Q5Z7J0\|GSK4_ORYSJ Shaggy-related protein kinase GSK4	76.200%	Swiss-Prot	Low
`Q60EZ2`	Oryza sativa subsp. japonica	sp\|Q60EZ2\|GSK2_ORYSJ Shaggy-related protein kinase GSK2	71.400%	Swiss-Prot	Low
`Q9LWN0`	Oryza sativa subsp. japonica	sp\|Q9LWN0\|GSK1_ORYSJ Shaggy-related protein kinase GSK1	71.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card