TkA06G015490 | RubberDandelionOmics

Gene overview

TkA06G015490

Reference: TK1151 Chr: Chr06 Coordinates: 4210502-4217768 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1730 bp · TkA06G015490|TK1151|cDNA

GTTCCGTCCACCAGACCTTGAGCCGCGCCATTATCTCCTTTGCCGAAGAGCATCGCAGGAATAGGTGTTCTTCATTCTCATCCTGCACATTACAAAGAGGACAGAGGGGAGTCACCCCCGCAACATTCCGTCTGATGAGGTTTTATTGAAGAATGACAAAGATAAGGATGTTATGGGTGATTACATGCCCAATCTCATCTATATCTCACGAGAAAAAAATAAAGCCATACCACACCATTTTAAGGCCGGTGCCCTTAACA...

CDS

Download CDS FASTA

1398 bp · TkA06G015490|TK1151|CDS

ATGGGTGATTACATGCCCAATCTCATCTATATCTCACGAGAAAAAAATAAAGCCATACCACACCATTTTAAGGCCGGTGCCCTTAACACTTTGATCAGAGTGTCAACAATCATGACAAATGCACCAATATTCATAACCTTAGATTGTGACATGTACTCAAACGATCCAAAGACACCACTTCGAATGTTATGTTATTTCTTAGATCCCAATCTTGATCCAAAGCTTGCATTTGTTCAATTTCCTCAACGCTTCGACAACAT...

Protein

Download Protein FASTA

465 aa · TkA06G015490|TK1151|PROTEIN

MGDYMPNLIYISREKNKAIPHHFKAGALNTLIRVSTIMTNAPIFITLDCDMYSNDPKTPLRMLCYFLDPNLDPKLAFVQFPQRFDNINKNDTYGAKHVMETRVCTAGMDGLGGTFFMGSCGFFRRQALIESPKDPQHIWNEPIQSKDISLAHHVASCRYEDNTIWGREIGFRYGTLVEDIYTSFRLQCLGWKSVTCDPTRAAFLGNMPIALSDILSQNNRWYMGMLQTALSKFSPLIFGMKFLNPFHALCYAHFHFRAFW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G015490`
TK1151 ID	TkA06G015490
OH-1004 ID	LXL04_026299
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 96.074 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G015490

Location Chr06:4210502-4217768 (+)

Description Similar to CSLG3: Cellulose synthase-like protein G3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24000`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`At4g23990`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`At4g24010`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`At1g55850`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0725300`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026299 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016759 cellulose synthase activity Molecular Function

GO:0016760 cellulose synthase (UDP-forming) activity Molecular Function

KEGG gene cross-reference

ath:AT4G23990

ath:AT4G24000

ath:AT4G24010

dosa:Os02g0725300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.376

Rank 1 · TkA06G015490 · TK1151

Cell membrane0.281

Rank 2 · TkA06G015490 · TK1151

Golgi apparatus0.211

Rank 3 · TkA06G015490 · TK1151

Cytoplasm0.123

Rank 4 · TkA06G015490 · TK1151

Lysosome / Vacuole0.114

Rank 5 · TkA06G015490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03552Cellulose_synt2-129 aa

PF13632Glyco_trans_2_356-262 aa

PF03552Cellulose_synt140-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G015490	`PF03552`	Cellulose_synt	2	129	3e-84	284.6
TkA06G015490	`PF13632`	Glyco_trans_2_3	56	262	1.4e-07	32.2
TkA06G015490	`PF03552`	Cellulose_synt	140	460	3e-84	284.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYR4`	Arabidopsis thaliana	sp\|Q8VYR4\|CSLG2_ARATH Cellulose synthase-like protein G2	48.100%	Swiss-Prot	Medium
`Q0WVN5`	Arabidopsis thaliana	sp\|Q0WVN5\|CSLG3_ARATH Cellulose synthase-like protein G3	49.800%	Swiss-Prot	Medium
`Q570S7`	Arabidopsis thaliana	sp\|Q570S7\|CSLG1_ARATH Cellulose synthase-like protein G1	47.900%	Swiss-Prot	Medium
`Q8VZK9`	Arabidopsis thaliana	sp\|Q8VZK9\|CSLE1_ARATH Cellulose synthase-like protein E1	39.200%	Swiss-Prot	Medium
`Q0DXZ1`	Oryza sativa subsp. japonica	sp\|Q0DXZ1\|CSLE2_ORYSJ Cellulose synthase-like protein E2	36.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card