TkA06G014960 | RubberDandelionOmics

Gene overview

TkA06G014960

Reference: TK1151 Chr: Chr06 Coordinates: 4017032-4019236 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1643 bp · TkA06G014960|TK1151|cDNA

ATCCAAGTCTTCATCTCTCTCTCTCTCTCTCTCTCTTCCACCTCTACGCGTTTTGGTGTCATCATTTGCTTCTTTGCTCAACCACAACCGTCATCTTGACCACTCTCCCCTTCTAATCCCACAATTGGAACCATTAAAAACATTTGAATATTCAAACTCATTCATTTACTATTTCAAAATATTGATATCGACACGTACTTCCTAGAAATTTCCTCCATCTTCCTATATATCTTTATAAATCTTCTCAACCCATATTTACT...

CDS

Download CDS FASTA

990 bp · TkA06G014960|TK1151|CDS

ATGGAGAACAACAATCAATCATCTTTCTGGCAATTCAGTGATCAGCTTCGTGTTCAGAACAACAACCTTTCAAATCTCTCTCTTAACGATTCCATTTGGAGCAGTTCGTATGTGTCGAAACGGCCGGAAAAGGATCGCCGGAATTTCGACATCCGTGTTGGCGGCGGTGTCGTTAACACCGGTACCGGCAGCAGCAACAACTCCGGCCCATCAAATTCAGATTTTAACGGGTTCAACTTTGATTGGAAGATCGGATCCTC...

Protein

Download Protein FASTA

329 aa · TkA06G014960|TK1151|PROTEIN

MENNNQSSFWQFSDQLRVQNNNLSNLSLNDSIWSSSYVSKRPEKDRRNFDIRVGGGVVNTGTGSSNNSGPSNSDFNGFNFDWKIGSSGNIGSTNLNPIGDFGVNGGFNKGIYTKPSLNLNQNLNQNSNTKVINGKGEGGDDKQGYGSKHWKNKKNHGNNKTSVNNNNNDKNGAKNSVDKRFKTLPPSESLPRNETVGGYIFVCNNDTMEENLKRELFGLPPRYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G014960`
TK1151 ID	TkA06G014960
OH-1004 ID	LXL04_026309
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G014960

Location Chr06:4017032-4019236 (-)

Description Similar to B2 protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42050`	Contributes to the initial phase of responses to abiotic and biotic stress signals (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026309 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1902074 response to salt Biological Process

GO:1904350 regulation of protein catabolic process in the vacuole Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G42050

gmx:100808989

gmx:547685

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.479

Rank 1 · TkA06G014960 · TK1151

Cytoplasm0.424

Rank 2 · TkA06G014960 · TK1151

Cell membrane0.137

Rank 3 · TkA06G014960 · TK1151

Endoplasmic reticulum0.061

Rank 4 · TkA06G014960 · TK1151

Lysosome / Vacuole0.036

Rank 5 · TkA06G014960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10539Dev_Cell_Death197-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G014960	`PF10539`	Dev_Cell_Death	197	324	1.4e-38	132.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXN8`	Arabidopsis thaliana	sp\|Q8RXN8\|NRP_ARATH DCD domain-containing protein NRP	53.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card