TkA06G014340 | RubberDandelionOmics

Gene overview

TkA06G014340

Reference: TK1151 Chr: Chr06 Coordinates: 3814743-3816308 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1498 bp · TkA06G014340|TK1151|cDNA

GATGTACATGCACGCCACTTTAAGTTTATGAACTTTCTCCTTAGTGGGGAATTTAACTGTAAAGATATACTTTGAGTAAAGGGGGGAAAATGAAGCAAGATTGGTGGAGGTCAGCTTACAACCAGAATTCGTTAGTTTTCAAGTTAGCGATTTCGATTTTGTTCCTAGGTTTTGGATTCAGACTTCTTTTCTCACAATCATCCGGTGTAATCATCCCCAATGTTTCCGATAACAATATCAATACTCCATTTCCTGCAAAT...

CDS

Download CDS FASTA

1062 bp · TkA06G014340|TK1151|CDS

ATGAAGCAAGATTGGTGGAGGTCAGCTTACAACCAGAATTCGTTAGTTTTCAAGTTAGCGATTTCGATTTTGTTCCTAGGTTTTGGATTCAGACTTCTTTTCTCACAATCATCCGGTGTAATCATCCCCAATGTTTCCGATAACAATATCAATACTCCATTTCCTGCAAATTTCTCCCAATCTCCCAAATATTTGAATCAATGTAATATTTCCGATGGTGAATGGATACCAAATTCCGGCGGACCACCGTACACCAACAA...

Protein

Download Protein FASTA

353 aa · TkA06G014340|TK1151|PROTEIN

MKQDWWRSAYNQNSLVFKLAISILFLGFGFRLLFSQSSGVIIPNVSDNNINTPFPANFSQSPKYLNQCNISDGEWIPNSGGPPYTNNSCRWIESDQNCLTNGRPDTGYLYWKWSPKACDLPRFDAHKFLETMRDKSWGFVGDSITRNHLQSFICHLSQVEDAVEIFHDKGYKNRKWRFPSYNLTVSVIWSPFLAKADVFEDINGVSSSEIELHIDILDKTWTEVFDTWDYVLFSSGKWFVKETIYYENNTILGCHGCQGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G014340`
TK1151 ID	TkA06G014340
OH-1004 ID	LXL04_026359
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.000
Protein coverage (%)	TK1151 99.433 / OH-1004 41.197 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G014340

Location Chr06:3814743-3816308 (-)

Description Similar to TBL23: Protein trichome birefringence-like 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11090`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At1g01430`	May be involved in the O-acetylation of mannan.	No verified direct reference in this release
`At4g23790`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At4g01080`	May be involved in the O-acetylation of mannan.	No verified direct reference in this release
`At5g15900`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026359 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0016020 membrane Cellular Component

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01430

ath:AT4G11090

ath:AT4G23790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.431

Rank 1 · TkA06G014340 · TK1151

Extracellular0.096

Rank 2 · TkA06G014340 · TK1151

Endoplasmic reticulum0.094

Rank 3 · TkA06G014340 · TK1151

Cell membrane0.090

Rank 4 · TkA06G014340 · TK1151

Lysosome / Vacuole0.063

Rank 5 · TkA06G014340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416PMR5N67-119 aa

PF13839PC-Esterase120-344 aa

PF14416PMR5N234-261 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G014340	`PF14416`	PMR5N	67	119	7.7e-20	71.7
TkA06G014340	`PF13839`	PC-Esterase	120	344	1.4e-58	199.8
TkA06G014340	`PF14416`	PMR5N	234	261	7.7e-20	71.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82509`	Arabidopsis thaliana	sp\|O82509\|TBL23_ARATH Protein trichome birefringence-like 23	46.300%	Swiss-Prot	Medium
`Q84JH9`	Arabidopsis thaliana	sp\|Q84JH9\|TBL25_ARATH Protein trichome birefringence-like 25	46.900%	Swiss-Prot	Medium
`Q8H1R3`	Arabidopsis thaliana	sp\|Q8H1R3\|TBL24_ARATH Protein trichome birefringence-like 24	46.000%	Swiss-Prot	Medium
`O04621`	Arabidopsis thaliana	sp\|O04621\|TBL26_ARATH Protein trichome birefringence-like 26	50.200%	Swiss-Prot	High
`Q9LFT0`	Arabidopsis thaliana	sp\|Q9LFT0\|TBL19_ARATH Protein trichome birefringence-like 19	39.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card