Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1086 bp · TkA06G014300|TK1151|cDNA
CCGACAAGAAGTTAGGGTTTTCTTATTCGCCCCGAAAATTCTTAAGTAGTTGAATTTAATAAACTTTATAGTGTATACCTACGCTTTATCTCAGTTTGATCAGAAAAAATGGCGTCAAAGAGACCGCGGTCCACCGAAATCGACGAACAAGTAGTGCAATTGATGAAACGAGCTGAAAGCTCGCCTGTGAAGTTCGATAATTACAATCATAAATCTCCGGTGGTCGTCTTTGCTCATGGAGCTGGTGCTCCTTCTACTTC...
765 bp · TkA06G014300|TK1151|CDS
ATGGCGTCAAAGAGACCGCGGTCCACCGAAATCGACGAACAAGTAGTGCAATTGATGAAACGAGCTGAAAGCTCGCCTGTGAAGTTCGATAATTACAATCATAAATCTCCGGTGGTCGTCTTTGCTCATGGAGCTGGTGCTCCTTCTACTTCCGATTGGATGATTAGATGGAGGAACCTGTTAACCAATGCTTTGAATCCTGTAGAAGTCGTAACTTTCGATTATCCATACATTTCTGGTAAAAGAAAAGCTGCACCAGA...
Protein
Download Protein FASTA254 aa · TkA06G014300|TK1151|PROTEIN
MASKRPRSTEIDEQVVQLMKRAESSPVKFDNYNHKSPVVVFAHGAGAPSTSDWMIRWRNLLTNALNPVEVVTFDYPYISGKRKAAPDPEKLVGFHLDFVRKVASKYPEHPLILIGKSLGSRVSCMVAAEKDIKVLGVVCLGYPLKAIKGAIRDEPLLKLTAPIMFVQGSNDSFCPLKLLEVVRKKLKILNELHVIEHGDHSFQIAKKNIELTGLTHQQAEERAAESIAMFVSKIRNEKEKVITQPSSTTVSLYQ
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G014300 |
|---|---|
| TK1151 ID | TkA06G014300 |
| OH-1004 ID | LXL04_026358 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.200 |
| Protein coverage (%) | TK1151 98.819 / OH-1004 97.287Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G014300 |
|---|---|
| Location | Chr06:3800308-3802373 (+) |
| Description | Similar to kansl3: KAT8 regulatory NSL complex subunit 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006325 chromatin organization Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:1903108 regulation of mitochondrial transcription Biological Process GO:0000123 histone acetyltransferase complex Cellular Component GO:0000922 spindle pole Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005874 microtubule Cellular Component GO:0044545 NSL complex Cellular Component |
| KEGG gene cross-reference | dre:555951 hsa:55683 hsa:93081 mmu:226976 rno:316328 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00151Lipase11-127 aaPF12146Hydrolase_432-58 aaPF20434BD-FAE33-134 aaPF20408Abhydrolase_1137-231 aaPF00561Abhydrolase_137-142 aaPF12697Abhydrolase_639-137 aaPF12146Hydrolase_480-141 aaPF12695Abhydrolase_591-201 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G014300 | PF00151 | Lipase | 11 | 127 | 0.0033 | 17.5 |
| TkA06G014300 | PF12146 | Hydrolase_4 | 32 | 58 | 4e-07 | 30.3 |
| TkA06G014300 | PF20434 | BD-FAE | 33 | 134 | 0.011 | 16.0 |
| TkA06G014300 | PF20408 | Abhydrolase_11 | 37 | 231 | 6.1e-39 | 134.5 |
| TkA06G014300 | PF00561 | Abhydrolase_1 | 37 | 142 | 1.5e-11 | 45.1 |
| TkA06G014300 | PF12697 | Abhydrolase_6 | 39 | 137 | 2.9e-06 | 28.8 |
| TkA06G014300 | PF12146 | Hydrolase_4 | 80 | 141 | 4e-07 | 30.3 |
| TkA06G014300 | PF12695 | Abhydrolase_5 | 91 | 201 | 0.00022 | 21.8 |
| TkA06G014300 | PF10230 | LIDHydrolase | 94 | 140 | 0.13 | 12.7 |
| TkA06G014300 | PF06259 | Abhydrolase_8 | 98 | 143 | 0.22 | 11.9 |
| TkA06G014300 | PF01738 | DLH | 107 | 227 | 0.0006 | 20.2 |
| TkA06G014300 | PF08386 | Abhydrolase_4 | 139 | 198 | 0.2 | 12.5 |
| TkA06G014300 | PF12697 | Abhydrolase_6 | 153 | 203 | 2.9e-06 | 28.8 |
| TkA06G014300 | PF00561 | Abhydrolase_1 | 155 | 204 | 1.5e-11 | 45.1 |
| TkA06G014300 | PF12146 | Hydrolase_4 | 158 | 201 | 4e-07 | 30.3 |
| TkA06G014300 | PF10230 | LIDHydrolase | 158 | 202 | 0.13 | 12.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.