TkA06G013430 | RubberDandelionOmics

Gene overview

TkA06G013430

Reference: TK1151 Chr: Chr06 Coordinates: 3513382-3515470 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

989 bp · TkA06G013430|TK1151|cDNA

AAACAATCAAGAAAAAAAGTCCTGAAAAAAGCTAATTTATCAAAGAGTTGATCAACGGCACCTTCAATCCTATTTTCGCTCCTCGCTCGAGATCATCTTCAGTTGCAGGCGCATAAGCATCAATAATCCACCATGTCTATCTCTGTAAAAGAATGCTGCTGTTTCTTGAAGAAACTTGGAAACCCTCGTCGAATAATACACTACGCTATTCTTGCTTCCGAGACATCATTTTCAATTAACGAAATAGAGGCATTACACGA...

CDS

Download CDS FASTA

666 bp · TkA06G013430|TK1151|CDS

ATGTCTATCTCTGTAAAAGAATGCTGCTGTTTCTTGAAGAAACTTGGAAACCCTCGTCGAATAATACACTACGCTATTCTTGCTTCCGAGACATCATTTTCAATTAACGAAATAGAGGCATTACACGATCTTTTTGAAACATTAAGTCACGCCATTATCGACGATGGTCTTATTCACAAGGAAGAGTTCCGACTGGCACTCTTCAGCAATACCAGCACGCAGAATCTGTTTGCAGATCGACTATTTGATATCTTTGACAT...

Protein

Download Protein FASTA

221 aa · TkA06G013430|TK1151|PROTEIN

MSISVKECCCFLKKLGNPRRIIHYAILASETSFSINEIEALHDLFETLSHAIIDDGLIHKEEFRLALFSNTSTQNLFADRLFDIFDIKKNGVIEFDEFVRSLSIFHPDAPESEKIEFMFRLYDLKQTGYIERDELKEMVCAILSEMDVDLSEDAVSAILDKTILDADQNGDGKIDIEEWKTFIPKYPTILKNMTLPLLREITQAFPNFVLNTQVRELEVVT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G013430`
TK1151 ID	TkA06G013430
OH-1004 ID	LXL04_029859
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	50.000
Protein coverage (%)	TK1151 86.878 / OH-1004 90.141 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G013430

Location Chr06:3513382-3515470 (+)

Description Similar to CBL9: Calcineurin B-like protein 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64480`	Acts as a calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0291000`	Acts as a calcium sensor.	No verified direct reference in this release
`Os02g0291400`	Acts as a calcium sensor.	Expression analysis of the calcineurin B-like gene family in rice (Oryza sativa L.) under environmental stresses.2008 · DOI: 10.1016/j.gene.2008.02.011
`Os05g0534400`	Acts as a calcium sensor involved in the regulatory pathway for the control of intracellular Na(+) and K(+) homeostasis and salt tolerance.	Conservation of the salt overly sensitive pathway in rice.2007 · DOI: 10.1104/pp.106.092635
`Os01g0598200`	Acts as a calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029859 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT4G17615

ath:AT5G47100

ath:AT5G55990

dosa:Os02g0291000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.485

Rank 1 · TkA06G013430 · TK1151

Cell membrane0.268

Rank 2 · TkA06G013430 · TK1151

Nucleus0.183

Rank 3 · TkA06G013430 · TK1151

Lysosome / Vacuole0.147

Rank 4 · TkA06G013430 · TK1151

Golgi apparatus0.115

Rank 5 · TkA06G013430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13405EF-hand_62-16 aa

PF00036EF-hand_13-15 aa

PF20743DUF5580_C18-39 aa

PF30347RSA-1_C52-66 aa

PF13499EF-hand_754-100 aa

PF13405EF-hand_654-67 aa

PF00036EF-hand_155-67 aa

PF13202EF-hand_555-64 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G013430	`PF13405`	EF-hand_6	2	16	1e-14	53.5
TkA06G013430	`PF00036`	EF-hand_1	3	15	7.4e-19	66.6
TkA06G013430	`PF20743`	DUF5580_C	18	39	0.084	13.7
TkA06G013430	`PF30347`	RSA-1_C	52	66	0.00049	21.0
TkA06G013430	`PF13499`	EF-hand_7	54	100	4.9e-16	59.5
TkA06G013430	`PF13405`	EF-hand_6	54	67	1e-14	53.5
TkA06G013430	`PF00036`	EF-hand_1	55	67	7.4e-19	66.6
TkA06G013430	`PF13202`	EF-hand_5	55	64	3.4e-13	49.1
TkA06G013430	`PF13833`	EF-hand_8	55	101	1.2e-07	32.0
TkA06G013430	`PF30347`	RSA-1_C	65	144	0.00049	21.0
TkA06G013430	`PF23564`	EF-hand_FSTL1	70	103	4.8e-05	24.4
TkA06G013430	`PF30624`	EF_SSP120	71	99	9.4e-06	26.9
TkA06G013430	`PF12763`	EH	78	100	0.01	16.4
TkA06G013430	`PF10591`	SPARC_Ca_bdg	78	99	0.025	15.6
TkA06G013430	`PF00036`	EF-hand_1	79	100	7.4e-19	66.6
TkA06G013430	`PF13202`	EF-hand_5	79	100	3.4e-13	49.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FUQ7`	Arabidopsis thaliana	sp\|Q9FUQ7\|CNBL8_ARATH Calcineurin B-like protein 8	57.700%	Swiss-Prot	High
`Q3HRP0`	Oryza sativa subsp. japonica	sp\|Q3HRP0\|CNBL7_ORYSJ Calcineurin B-like protein 7	57.400%	Swiss-Prot	High
`Q3HRN9`	Oryza sativa subsp. japonica	sp\|Q3HRN9\|CNBL8_ORYSJ Calcineurin B-like protein 8	56.400%	Swiss-Prot	High
`Q75KU4`	Oryza sativa subsp. japonica	sp\|Q75KU4\|CNBL4_ORYSJ Calcineurin B-like protein 4	51.400%	Swiss-Prot	High
`Q3HRP2`	Oryza sativa subsp. japonica	sp\|Q3HRP2\|CNBL5_ORYSJ Calcineurin B-like protein 5	53.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card