TkA06G011740 | RubberDandelionOmics

Gene overview

TkA06G011740

Reference: TK1151 Chr: Chr06 Coordinates: 3077057-3078221 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

727 bp · TkA06G011740|TK1151|cDNA

CCACAGCTATCGTTTCCGTATTTATTGTCTTTATATATATTTTCTAGAAATCGCGCCAATCTTCCTTTCTACTCCGCTGTGTTTCCTTCATTTTCCGGCGATTCCGCCGGTGATTTTGCAAGCAATCGTTTTATGGTACAGTGATCTGTAATCGGGTTCAATGGCGACTTCACCGGTAGAATCTACGGAAGGAGAGTCGCAGAGAACTATTCCGTCGCCTTTTTTGACTAAAACCTACCAACTTGTTGACGATTTCTCAT...

CDS

Download CDS FASTA

567 bp · TkA06G011740|TK1151|CDS

ATGGCGACTTCACCGGTAGAATCTACGGAAGGAGAGTCGCAGAGAACTATTCCGTCGCCTTTTTTGACTAAAACCTACCAACTTGTTGACGATTTCTCATCAGACGAATTGATATCATGGAACCAACATGGAAATGCATTCATCGTTTGGCGCCCTGCTGAATTTGCTAGAGACCTGCTTCCGAAATACTTCAAACACAACAACTTCTCAAGCTTCATTCGACAGCTAAACAATACGACTTGTACCAGCAAACCGGAGCT...

Protein

Download Protein FASTA

188 aa · TkA06G011740|TK1151|PROTEIN

MATSPVESTEGESQRTIPSPFLTKTYQLVDDFSSDELISWNQHGNAFIVWRPAEFARDLLPKYFKHNNFSSFIRQLNNTTCTSKPELLEENERLKEHNSNLRYELDHLRSLCSNVVTLMSNFLSENDNGGSEEKAVEGGDGGAHVEEYMCPRLFGVPIGVKRVRRSEENAIIEQCDDEMLEWQQFNVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G011740`
TK1151 ID	TkA06G011740
OH-1004 ID	LXL04_026472
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	69.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G011740

Location Chr06:3077057-3078221 (+)

Description Similar to HSFB2B: Heat stress transcription factor B-2b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11660`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release
`At4g36990`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0546800`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release
`Os09g0526600`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026472 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT4G11660

ath:AT5G62020

dosa:Os04g0568700

dosa:Os08g0546800

dosa:Os09g0526600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.954

Rank 1 · TkA06G011740 · TK1151

Cytoplasm0.129

Rank 2 · TkA06G011740 · TK1151

Cell membrane0.021

Rank 3 · TkA06G011740 · TK1151

Endoplasmic reticulum0.011

Rank 4 · TkA06G011740 · TK1151

Mitochondrion0.010

Rank 5 · TkA06G011740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00447HSF_DNA-bind21-78 aa

PF02183HALZ87-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G011740	`PF00447`	HSF_DNA-bind	21	78	2.3e-19	70.5
TkA06G011740	`PF02183`	HALZ	87	111	0.39	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T0D3`	Arabidopsis thaliana	sp\|Q9T0D3\|HFB2B_ARATH Heat stress transcription factor B-2b	33.600%	Swiss-Prot	Medium
`Q96320`	Arabidopsis thaliana	sp\|Q96320\|HSFB1_ARATH Heat stress transcription factor B-1	72.300%	Swiss-Prot	Low
`Q6Z9C8`	Oryza sativa subsp. japonica	sp\|Q6Z9C8\|HFB2B_ORYSJ Heat stress transcription factor B-2b	77.300%	Swiss-Prot	Low
`Q652B0`	Oryza sativa subsp. japonica	sp\|Q652B0\|HFB2C_ORYSJ Heat stress transcription factor B-2c	76.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card