TkA06G011520 | RubberDandelionOmics

Gene overview

TkA06G011520

Reference: TK1151 Chr: Chr06 Coordinates: 3018304-3021648 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2692 bp · TkA06G011520|TK1151|cDNA

CAGAACCCTCAACAAAACTTGAACCTCGTCTCCAGTTCTTCGATTTCAACCGTTTAAACCCTCAAAACCCTAAACAAGTACCTCTAAATCATAAAAAATGAACTCATCAGTTATCTTCTTAGAACGTTCTAGGATATTCCGCTACAATGTTCTGCACAATCTCACCTTCCTCCGCCACATGGGCGGCGGCCCACGGACGTTCCCTGGCGGCCTGAACAAATGGCAATGGAAGCGCCTCCACGAAAAGCAAGCCAGGGAGA...

CDS

Download CDS FASTA

948 bp · TkA06G011520|TK1151|CDS

ATGGGATTAAAATTGCTTATACTTGATGAAGCAGACCATTTACTTGACCTAGGCTTCCGGAAGGACATGGAGAAAATAGTTGACTGTTTACCTCGTCAAAGACAATCTTTGCTCTTTTCTGCAACACTTCCTAAAGAGGTTCGAAGAGTATCTCAGCTTGTTTTAAAAAGGGATCATGCGTATATAAACACAGTCGGGTTAGGTCCAGAAACACACGATAAAGTTAATCAATCTTACATTATCGCCCCCCATGAACAACA...

Protein

Download Protein FASTA

315 aa · TkA06G011520|TK1151|PROTEIN

MGLKLLILDEADHLLDLGFRKDMEKIVDCLPRQRQSLLFSATLPKEVRRVSQLVLKRDHAYINTVGLGPETHDKVNQSYIIAPHEQHFQIVHHLLKDHIAQTPSYKVIVFCTTAMMTSLMFSLFREMKMNVREIHSRKPQLYRTRVSEEFKEAKQLVLITSDVSARGMNYPDVSLVIQVGVPVDREQYINRLGRTGREGKGGEGIMLLAPWEEYFLEEIKDLPVHKSSSPHLDPDMKLKIDKSMEKVDPSVKEAAYHAWL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G011520`
TK1151 ID	TkA06G011520
OH-1004 ID	LXL04_026466
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 39.130 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G011520

Location Chr06:3018304-3021648 (-)

Description Similar to RH48: Probable DEAD-box ATP-dependent RNA helicase 48

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63250`	Probable DEAD-box ATP-dependent RNA helicase 48.	No verified direct reference in this release
`At2g07750`	Putative DEAD-box ATP-dependent RNA helicase 33.	No verified direct reference in this release
`At5g08610`	DEAD-box ATP-dependent RNA helicase 26.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0826100`	DEAD-box ATP-dependent RNA helicase 48.	No verified direct reference in this release
`Os06g0526600`	DEAD-box ATP-dependent RNA helicase 31.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026466 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT1G63250

ath:AT2G07750

ath:AT5G08610

dosa:Os02g0826100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.791

Rank 1 · TkA06G011520 · TK1151

Cytoplasm0.215

Rank 2 · TkA06G011520 · TK1151

Mitochondrion0.066

Rank 3 · TkA06G011520 · TK1151

Cell membrane0.021

Rank 4 · TkA06G011520 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA06G011520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270DEAD3-49 aa

PF17370DUF539242-64 aa

PF00271Helicase_C94-199 aa

PF00270DEAD100-130 aa

PF17370DUF5392104-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G011520	`PF00270`	DEAD	3	49	1.3e-11	45.2
TkA06G011520	`PF17370`	DUF5392	42	64	0.12	13.3
TkA06G011520	`PF00271`	Helicase_C	94	199	4.7e-21	75.8
TkA06G011520	`PF00270`	DEAD	100	130	1.3e-11	45.2
TkA06G011520	`PF17370`	DUF5392	104	147	0.12	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8S9`	Arabidopsis thaliana	sp\|Q9C8S9\|RH48_ARATH Probable DEAD-box ATP-dependent RNA helicase 48	74.100%	Swiss-Prot	High
`O80792`	Arabidopsis thaliana	sp\|O80792\|RH33_ARATH Putative DEAD-box ATP-dependent RNA helicase 33	70.600%	Swiss-Prot	High
`Q9FNM7`	Arabidopsis thaliana	sp\|Q9FNM7\|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26	58.500%	Swiss-Prot	High
`Q6K7R9`	Oryza sativa subsp. japonica	sp\|Q6K7R9\|RH48_ORYSJ DEAD-box ATP-dependent RNA helicase 48	69.300%	Swiss-Prot	High
`Q0DBU5`	Oryza sativa subsp. japonica	sp\|Q0DBU5\|RH31_ORYSJ DEAD-box ATP-dependent RNA helicase 31	59.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card