Gene Card
Gene overview
cDNA / CDS / Protein Sequences
7139 bp · TkA06G010760|TK1151|cDNA
GAAACAATGGGCTGCGTTTGAAGCAAAGCAAGCATTTCAAATGAGTTGCGTTTGGAGCAAGGCAAACCCGTACCGACCCGTTTTACCGACTTTGAAAACCTAGGCGGTCTCCTTCTCACAGACTACACTCGTCTGATATATATATCTTCAACCACGATAACTGGAATTTTCCAATCTCGCTGCTCAAGAATTTGGTATCAGAATACGGTTTTGTTGAATTAAAAGCGGTTGATAAACGATGGCACATCTAGGCGGGGGTG...
4995 bp · TkA06G010760|TK1151|CDS
ATGGCACATCTAGGCGGGGGTGCTGAGGCACATGCCCGATTTAAGCAGTATGAATACAGAGCCAACTCGAGTCTTGTGTTGACAACTGATTCTCGGCCACGTGATACACATGAGCCAACCGGAGAGCCTGAGTCTCTGTATGGGAAGATAGACCCTAAGAGTTTTGGTGACCGTGCTTATAGAGGAAGACCACAAGAGCTGGATGAGAAAATCACCAAGTCTAAGAAGAAGAAGGAACGTGATCCCTCACTTGCTTCTGG...
Protein
Download Protein FASTA1664 aa · TkA06G010760|TK1151|PROTEIN
MAHLGGGAEAHARFKQYEYRANSSLVLTTDSRPRDTHEPTGEPESLYGKIDPKSFGDRAYRGRPQELDEKITKSKKKKERDPSLASGEAGNNRHSKRRRLQEESVLTSTDEGVYQPKTKETRAAYEAMLSVIQTQLGGQPLNIVSGAADEILAVLKSDTLKNPEKKKDIEKLLNPIPNQVFDQLVSIGRLITDFQDAGGDADGSNAANGEDALDDDVGVAVEFEENEEDDEESDLDIVQEDDEDEDDDGLDRDKSKAMQM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G010760 |
|---|---|
| TK1151 ID | TkA06G010760 |
| OH-1004 ID | LXL04_026453 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 98.300 |
| Protein coverage (%) | TK1151 97.776 / OH-1004 74.537Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G010760 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:2784271-2792079 (-) | |||||||||
| Description | Similar to BRR2A: DExH-box ATP-dependent RNA helicase DExH12 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000244 spliceosomal tri-snRNP complex assembly Biological Process GO:0000354 cis assembly of pre-catalytic spliceosome Biological Process GO:0000387 spliceosomal snRNP assembly Biological Process GO:0000388 spliceosome conformational change to release U4 (or U4atac) and U1 (or U11) Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006397 mRNA processing Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0048025 negative regulation of mRNA splicing, via spliceosome Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005682 U5 snRNP Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G20960 ath:AT2G42270 hsa:23020 mmu:320632 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13086AAA_1167-126 aaPF21188BRR2_plug121-186 aaPF18149Helicase_PWI277-386 aaPF13086AAA_11285-408 aaPF00271Helicase_C329-371 aaPF23931Terminase_6355-398 aaPF13604AAA_30516-686 aaPF13086AAA_11516-615 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G010760 | PF13086 | AAA_11 | 67 | 126 | 0.12 | 12.8 |
| TkA06G010760 | PF21188 | BRR2_plug | 121 | 186 | 6.2e-10 | 40.1 |
| TkA06G010760 | PF18149 | Helicase_PWI | 277 | 386 | 1.1e-34 | 119.7 |
| TkA06G010760 | PF13086 | AAA_11 | 285 | 408 | 0.12 | 12.8 |
| TkA06G010760 | PF00271 | Helicase_C | 329 | 371 | 2.6e-10 | 41.2 |
| TkA06G010760 | PF23931 | Terminase_6 | 355 | 398 | 0.11 | 13.8 |
| TkA06G010760 | PF13604 | AAA_30 | 516 | 686 | 8.2e-06 | 26.4 |
| TkA06G010760 | PF13086 | AAA_11 | 516 | 615 | 0.12 | 12.8 |
| TkA06G010760 | PF04851 | ResIII | 517 | 692 | 4.4e-27 | 95.7 |
| TkA06G010760 | PF00270 | DEAD | 519 | 696 | 5.4e-68 | 228.7 |
| TkA06G010760 | PF12775 | AAA_7 | 525 | 556 | 0.071 | 13.4 |
| TkA06G010760 | PF00437 | T2SSE | 525 | 557 | 0.099 | 12.0 |
| TkA06G010760 | PF13401 | AAA_22 | 532 | 667 | 1.3e-07 | 32.8 |
| TkA06G010760 | PF00271 | Helicase_C | 568 | 613 | 2.6e-10 | 41.2 |
| TkA06G010760 | PF00271 | Helicase_C | 813 | 895 | 2.6e-10 | 41.2 |
| TkA06G010760 | PF00437 | T2SSE | 819 | 850 | 0.099 | 12.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.