TkA06G010380 | RubberDandelionOmics

Gene overview

TkA06G010380

Reference: TK1151 Chr: Chr06 Coordinates: 2655084-2655506 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · TkA06G010380|TK1151|cDNA

ATGTTGTGGAACAAAGATACTTATATTGTTGTTTTTGGTCTTTGTGCTCGCCTTCAAGATTTGAACTTGGGGCGACAAGTTCACAAGAAGCTGCTAATGAGTGATGTTACGTATGATGAGTCTGTATGTAATGCAATAATGAAGATGTATGGGAAATGTAAAGAGATTTCAAGTGCTAGAAAAGTTTTTGACACGTGTGAACCTCCTCCAAACGTGACTCTATGGACAACATTTTTGGCGGCTTACTTAGAAAATGGGTC...

CDS

Download CDS FASTA

423 bp · TkA06G010380|TK1151|CDS

ATGTTGTGGAACAAAGATACTTATATTGTTGTTTTTGGTCTTTGTGCTCGCCTTCAAGATTTGAACTTGGGGCGACAAGTTCACAAGAAGCTGCTAATGAGTGATGTTACGTATGATGAGTCTGTATGTAATGCAATAATGAAGATGTATGGGAAATGTAAAGAGATTTCAAGTGCTAGAAAAGTTTTTGACACGTGTGAACCTCCTCCAAACGTGACTCTATGGACAACATTTTTGGCGGCTTACTTAGAAAATGGGTC...

Protein

Download Protein FASTA

140 aa · TkA06G010380|TK1151|PROTEIN

MLWNKDTYIVVFGLCARLQDLNLGRQVHKKLLMSDVTYDESVCNAIMKMYGKCKEISSARKVFDTCEPPPNVTLWTTFLAAYLENGSFKKSLLGFIDMQRSDVVQMNLFLYSTHCYCRVIVFEQREYVTCTYSQDWIQGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G010380`
TK1151 ID	TkA06G010380
OH-1004 ID	LXL04_026439
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.800
Protein coverage (%)	TK1151 63.571 / OH-1004 18.313 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G010380

Location Chr06:2655084-2655506 (+)

Description Similar to EMB2744: Pentatricopeptide repeat-containing protein At5g39680

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15720`	Pentatricopeptide repeat-containing protein At4g15720.	No verified direct reference in this release
`At3g51320`	Pentatricopeptide repeat-containing protein At3g51320.	No verified direct reference in this release
`At2g29760`	Involved in RNA editing event in chloroplasts.	A study of new Arabidopsis chloroplast RNA editing mutants reveals general features of editing factors and their target sites.2009 · DOI: 10.1105/tpc.109.071472
`At2g22070`	Pentatricopeptide repeat-containing protein At2g22070.	No verified direct reference in this release
`At3g26540`	Pentatricopeptide repeat-containing protein At3g26540.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026439 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009451 RNA modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G13650

ath:AT5G39680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.662

Rank 1 · TkA06G010380 · TK1151

Plastid0.194

Rank 2 · TkA06G010380 · TK1151

Cytoplasm0.055

Rank 3 · TkA06G010380 · TK1151

Nucleus0.047

Rank 4 · TkA06G010380 · TK1151

Peroxisome0.013

Rank 5 · TkA06G010380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041PPR_24-15 aa

PF01535PPR7-33 aa

PF29376PRP6_TPR15-90 aa

PF29070MSC6_N26-90 aa

PF13041PPR_240-64 aa

PF01535PPR42-64 aa

PF13041PPR_270-103 aa

PF01535PPR74-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G010380	`PF13041`	PPR_2	4	15	4e-07	30.8
TkA06G010380	`PF01535`	PPR	7	33	6e-06	26.9
TkA06G010380	`PF29376`	PRP6_TPR	15	90	0.2	11.0
TkA06G010380	`PF29070`	MSC6_N	26	90	0.0016	18.3
TkA06G010380	`PF13041`	PPR_2	40	64	4e-07	30.8
TkA06G010380	`PF01535`	PPR	42	64	6e-06	26.9
TkA06G010380	`PF13041`	PPR_2	70	103	4e-07	30.8
TkA06G010380	`PF01535`	PPR	74	102	6e-06	26.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYH0`	Arabidopsis thaliana	sp\|Q8VYH0\|PP313_ARATH Pentatricopeptide repeat-containing protein At4g15720	33.700%	Swiss-Prot	Medium
`Q0WVU0`	Arabidopsis thaliana	sp\|Q0WVU0\|PP278_ARATH Pentatricopeptide repeat-containing protein At3g51320	32.500%	Swiss-Prot	Medium
`O82380`	Arabidopsis thaliana	sp\|O82380\|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic	38.000%	Swiss-Prot	Medium
`Q9SHZ8`	Arabidopsis thaliana	sp\|Q9SHZ8\|PP168_ARATH Pentatricopeptide repeat-containing protein At2g22070	29.200%	Swiss-Prot	Low
`Q9LRV2`	Arabidopsis thaliana	sp\|Q9LRV2\|PP256_ARATH Pentatricopeptide repeat-containing protein At3g26540	28.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card