TkA06G009920 | RubberDandelionOmics

Gene overview

TkA06G009920

Reference: TK1151 Chr: Chr06 Coordinates: 2535016-2541149 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3422 bp · TkA06G009920|TK1151|cDNA

CTCCCTTGCTCTCACAGTTTACTTCTCAAAGAAAAATAAAATTGAGGGTTTAATAATAAACTACACAATCTCTCTCTCAATTTCATTTCTCTATCCTCTTTGTTGTGCTGCTTCTTTTCTTCAGCGTCTCTTCGGTAACTGACACACTTCTCTGCAAGAAAGCTGTAAATTTCCCGCCGGCTTCCGGCACTTTTCTCTCCGCTTACGGAGCACCGGTCATTCGATTTATTGCTATTTATTTCATGATTACGGAAGCAGAG...

CDS

Download CDS FASTA

1746 bp · TkA06G009920|TK1151|CDS

ATGTCTCCATGGTGGAACAAATCTTCATCCGAAGAAGTGAAGAAGAAATCAAACGGTGGGGGTATTTTCGGAACAATTCAAAGAAAGTTGAAAAGCCCAAAACAAAGCCCAAAAGGATCCAACTCCCGTGTGTGTACCCGGTCATCTTCTCCATCAACACTAGTGGCTAGATCCCAAAGTTTTGCAGAAAGACCACTCGCACATCCACTCCCACTTCCTGATGTTCGTGTTGCTGACTCAGCTAAAAGGGCATCAAGAAG...

Protein

Download Protein FASTA

581 aa · TkA06G009920|TK1151|PROTEIN

MSPWWNKSSSEEVKKKSNGGGIFGTIQRKLKSPKQSPKGSNSRVCTRSSSPSTLVARSQSFAERPLAHPLPLPDVRVADSAKRASRRSGIGKGSSLPPPKHSRSQNAPGHVDLEGDLATDSVFTDTDTDTDDPPDSRLVSPQASDYDKTSTNSPSNPYKNQNHIARQKKREKSKPANTCLNNQTVPTSPKRRPLNSHMAKLQIPQSGAFFSAPDSSMSSPSRSPMRAFGPDPTLTSGFWASRPYADPGFLGSGQCSSPGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G009920`
TK1151 ID	TkA06G009920
OH-1004 ID	LXL04_021652
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.500
Protein coverage (%)	TK1151 88.124 / OH-1004 60.259 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G009920

Location Chr06:2535016-2541149 (+)

Description Similar to YDA: Mitogen-activated protein kinase kinase kinase YODA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63700`	Functions in a MAP kinase cascade that acts as a molecular switch to regulate the first cell fate decisions in the zygote and the early embryo.	No verified direct reference in this release
`At1g53570`	Mitogen-activated protein kinase kinase kinase 3.	No verified direct reference in this release
`At5g66850`	Mitogen-activated protein kinase (MAPK) involved in the transduction of signal between the host cell surface chitin receptor complex CERK1-LYK5 and the intracellular MAPK cascade that leads to chitin-induced immunity.	The Arabidopsis CERK1-associated kinase PBL27 connects chitin perception to MAPK activation.2016 · DOI: 10.15252/embj.201694248
`At1g09000`	May be involved in an oxidative stress-mediated signaling cascade that phosphorylates downstream MAP kinases MPK3 and MPK6.	Functional analysis of oxidative stress-activated mitogen-activated protein kinase cascade in plants.2000 · DOI: 10.1073/pnas.97.6.2940 An Arabidopsis mitogen-activated protein kinase kinase kinase gene family encodes essential positive regulators of cytokinesis.2002 · DOI: 10.1105/tpc.001164
`At1g54960`	Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.	Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021652 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0010098 suspensor development Biological Process

GO:0010103 stomatal complex morphogenesis Biological Process

GO:0010229 inflorescence development Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G09000

ath:AT1G53570

ath:AT1G54960

ath:AT1G63700

ath:AT5G66850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.656

Rank 1 · TkA06G009920 · TK1151

Nucleus0.278

Rank 2 · TkA06G009920 · TK1151

Cell membrane0.172

Rank 3 · TkA06G009920 · TK1151

Golgi apparatus0.042

Rank 4 · TkA06G009920 · TK1151

Mitochondrion0.041

Rank 5 · TkA06G009920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00264Tyrosinase132-286 aa

PF14531Kinase-like389-448 aa

PF00069Pkinase391-545 aa

PF07714PK_Tyr_Ser-Thr393-540 aa

PF03109ABC1434-541 aa

PF14531Kinase-like478-535 aa

PF07387Seadorna_VP7500-534 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G009920	`PF00264`	Tyrosinase	132	286	0.26	12.4
TkA06G009920	`PF14531`	Kinase-like	389	448	0.0028	17.7
TkA06G009920	`PF00069`	Pkinase	391	545	3.5e-44	151.9
TkA06G009920	`PF07714`	PK_Tyr_Ser-Thr	393	540	5.2e-31	108.6
TkA06G009920	`PF03109`	ABC1	434	541	1.2e-05	25.3
TkA06G009920	`PF14531`	Kinase-like	478	535	0.0028	17.7
TkA06G009920	`PF07387`	Seadorna_VP7	500	534	0.12	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAD5`	Arabidopsis thaliana	sp\|Q9CAD5\|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA	57.800%	Swiss-Prot	High
`F4HRJ4`	Arabidopsis thaliana	sp\|F4HRJ4\|M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3	51.100%	Swiss-Prot	Low
`Q9C5H5`	Arabidopsis thaliana	sp\|Q9C5H5\|M3K5G_ARATH Mitogen-activated protein kinase kinase kinase 5	54.700%	Swiss-Prot	Low
`O22040`	Arabidopsis thaliana	sp\|O22040\|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1	51.600%	Swiss-Prot	Low
`Q9FZ36`	Arabidopsis thaliana	sp\|Q9FZ36\|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2	50.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card