TkA06G008670 | RubberDandelionOmics

Gene overview

TkA06G008670

Reference: TK1151 Chr: Chr06 Coordinates: 2181104-2183107 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1575 bp · TkA06G008670|TK1151|cDNA

CGAAAATTGTCGTAAACTATTTTTTCACACGATTCTTTTTGGGAATATAGAATTCACACAATCATTGTAAACCTTCTTTAGTTACTTGGACTTTAAAGATCCCGTTCAAAATGGTATCTACTATTCTTCAAGATTCTATAATGCAAAGATAAGATTATAATTTAAACTTATGCCCTTCATGTTACACACTTACTTAAGTCCAACCCCTCACCGCCTTACAAATTCCAACACCACCCCTACAACGTGGTGAATCCTGGGCC...

CDS

Download CDS FASTA

837 bp · TkA06G008670|TK1151|CDS

ATGGCTTCTCTGATCCTTCCTACAAATCAAAACCCACTATCGTCTTCATTTCTGCATCAGAATCATCAAAACGCTCCGTTTTTCACGAACAAAAGAAGAAAGCTAACGAGGAATCGAACCCTAGTTCCTGTTGCAAGATTATTTGGGCCTTCGATATTTGAAGCTTCAAAATTGAAGGTTCTGTTTCTAGGAGTAGATGAGAAGAAGCATCCTGGAAAACTTCCAAGAACATATACACTTACACATAGCGACATCACTTC...

Protein

Download Protein FASTA

278 aa · TkA06G008670|TK1151|PROTEIN

MASLILPTNQNPLSSSFLHQNHQNAPFFTNKRRKLTRNRTLVPVARLFGPSIFEASKLKVLFLGVDEKKHPGKLPRTYTLTHSDITSKLTLAISQTINNSQLQGWYNQLYRDEVVAEWKKVKGNMSLHVHCHISGGHFLLDLFARLRFFIFTKELPLVLKAFAHGDGNLLNSYPELQEASVWVYFHSNVQEFNRVECWGPLREAERPLSTSASPSPSSSGSTIDEAEEGSSKWEIPKPCVEACACCFPPMSSIPWSHDHV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G008670`
TK1151 ID	TkA06G008670
OH-1004 ID	LXL04_026497
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G008670

Location Chr06:2181104-2183107 (-)

Description Similar to SGR1: Protein STAY-GREEN 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22920`	Magnesium chelatase involved in chlorophyll a degradation in the chlorophyll-protein complexes of photosystem I (PSI) and photosystem II (PSII).	Identification of a novel chloroplast protein AtNYE1 regulating chlorophyll degradation during leaf senescence in Arabidopsis.2007 · DOI: 10.1104/pp.107.100172 NYEs/SGRs-mediated chlorophyll degradation is critical for detoxification during seed maturation in Arabidopsis.2017 · DOI: 10.1111/tpj.13710

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026497 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010271 regulation of chlorophyll catabolic process Biological Process

GO:0015996 chlorophyll catabolic process Biological Process

GO:1903647 negative regulation of chlorophyll catabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0055035 plastid thylakoid membrane Cellular Component

GO:0016829 lyase activity Molecular Function

KEGG gene cross-reference

ath:AT4G11910

ath:AT4G22920

cann:107866321

sly:778212

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.892

Rank 1 · TkA06G008670 · TK1151

Nucleus0.090

Rank 2 · TkA06G008670 · TK1151

Mitochondrion0.051

Rank 3 · TkA06G008670 · TK1151

Cytoplasm0.046

Rank 4 · TkA06G008670 · TK1151

Cell membrane0.040

Rank 5 · TkA06G008670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12638Staygreen53-204 aa

PF10017Methyltransf_3359-131 aa

PF10017Methyltransf_33168-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G008670	`PF12638`	Staygreen	53	204	1.2e-55	188.1
TkA06G008670	`PF10017`	Methyltransf_33	59	131	0.068	12.9
TkA06G008670	`PF10017`	Methyltransf_33	168	192	0.068	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82741`	Arabidopsis thaliana	sp\|O82741\|SGR1_ARATH Magnesium dechelatase SGR1, chloroplastic	64.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card