TkA06G008620 | RubberDandelionOmics

Gene overview

TkA06G008620

Reference: TK1151 Chr: Chr06 Coordinates: 2171553-2172610 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

621 bp · TkA06G008620|TK1151|cDNA

ATGGGAGGTGCTTGTGGATACGGAAATACGATGACAAACGGATACGGTACAAATACAGCAGCATTGAGCTCAACCATCTTTAGCAACGGATACGCGTGTGGCCAATGTTACCAAATAAAATGTGTCCAATCTCCATGGTGCTCAAAAGGTGTCGCCACTGTAACCGCAACAAACCTTTGTCCCCCAAACTGGTCAAAAGATTCAAACAAAGGCGGATGGTGCAACCCCCCTCGAACCCATTTCGACATGGCTAAGCCCGC...

CDS

Download CDS FASTA

621 bp · TkA06G008620|TK1151|CDS

ATGGGAGGTGCTTGTGGATACGGAAATACGATGACAAACGGATACGGTACAAATACAGCAGCATTGAGCTCAACCATCTTTAGCAACGGATACGCGTGTGGCCAATGTTACCAAATAAAATGTGTCCAATCTCCATGGTGCTCAAAAGGTGTCGCCACTGTAACCGCAACAAACCTTTGTCCCCCAAACTGGTCAAAAGATTCAAACAAAGGCGGATGGTGCAACCCCCCTCGAACCCATTTCGACATGGCTAAGCCCGC...

Protein

Download Protein FASTA

206 aa · TkA06G008620|TK1151|PROTEIN

MGGACGYGNTMTNGYGTNTAALSSTIFSNGYACGQCYQIKCVQSPWCSKGVATVTATNLCPPNWSKDSNKGGWCNPPRTHFDMAKPAFMQIAQWKAGIVPVVYRRVPCVRKGGLRFSFQGNGYWLLVYVMNVGGAGDIKSMWVKGTKTGWLSMSHNWGVSYQAFATLRGQALSFRLTSYTTKQTITAYNVAPANWNLGCRVINCGT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G008620`
TK1151 ID	TkA06G008620
OH-1004 ID	LXL04_026499
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 95.631 / OH-1004 23.879 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G008620

Location Chr06:2171553-2172610 (+)

Description Similar to EXPA7: Expansin-A7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12560`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At1g62980`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At5g56320`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	LBD18 acts as a transcriptional activator that directly binds to the EXPANSIN14 promoter in promoting lateral root emergence of Arabidopsis.2013 · DOI: 10.1111/tpj.12013

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0535900`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os03g0155300`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026499 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0009853 photorespiration Biological Process

GO:0009854 oxidative photosynthetic carbon pathway Biological Process

GO:0048767 root hair elongation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0016618 hydroxypyruvate reductase [NAD(P)H] activity Molecular Function

GO:0030267 glyoxylate reductase (NADPH) activity Molecular Function

GO:0051287 NAD binding Molecular Function

GO:0120509 hydroxypyruvate reductase (NADPH) activity Molecular Function

KEGG gene cross-reference

ath:AT1G12550

ath:AT1G12560

ath:AT1G62980

osa:107277540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.788

Rank 1 · TkA06G008620 · TK1151

Cytoplasm0.101

Rank 2 · TkA06G008620 · TK1151

Lysosome / Vacuole0.065

Rank 3 · TkA06G008620 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA06G008620 · TK1151

Cell membrane0.025

Rank 5 · TkA06G008620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29515Expansin_N2-92 aa

PF22514EXPB1_D13-108 aa

PF03330DPBB_119-103 aa

PF01357Expansin_C115-192 aa

PF22514EXPB1_D1184-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G008620	`PF29515`	Expansin_N	2	92	2.4e-09	38.1
TkA06G008620	`PF22514`	EXPB1_D1	3	108	1.1e-05	26.5
TkA06G008620	`PF03330`	DPBB_1	19	103	2.1e-21	76.6
TkA06G008620	`PF01357`	Expansin_C	115	192	5.4e-26	91.2
TkA06G008620	`PF22514`	EXPB1_D1	184	185	1.1e-05	26.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LN94`	Arabidopsis thaliana	sp\|Q9LN94\|EXPA7_ARATH Expansin-A7	72.900%	Swiss-Prot	High
`Q9LQ07`	Arabidopsis thaliana	sp\|Q9LQ07\|EXP18_ARATH Expansin-A18	69.500%	Swiss-Prot	High
`Q9FMA0`	Arabidopsis thaliana	sp\|Q9FMA0\|EXP14_ARATH Expansin-A14	57.300%	Swiss-Prot	High
`Q8W2X8`	Oryza sativa subsp. japonica	sp\|Q8W2X8\|EXP30_ORYSJ Putative expansin-A30	67.000%	Swiss-Prot	High
`Q7G6Z2`	Oryza sativa subsp. japonica	sp\|Q7G6Z2\|EXP12_ORYSJ Expansin-A12	60.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card