TkA06G008600 | RubberDandelionOmics

Gene overview

TkA06G008600

Reference: TK1151 Chr: Chr06 Coordinates: 2163732-2166483 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1364 bp · TkA06G008600|TK1151|cDNA

CCACGGCAACGGAAAGCCGAAAACCAGAGTTGGCCCAAAGGGGCTTTTCCGGGACAATTAGGGCACAGCTTATCCACTCGCACCATCGAGACCACTCTCCAGTCTCCCCTGAGGATTAGCGTTCTCGTGAAAGGAAAGAAAGAGGTCATGTCTGTTGATAATTCTGTAGTTGATTCCTCAGTGACTGATTGGAAGCCTGATGTAGAGAATAAGAACAACCAAGAAAGCCAAAATGACAAAGTAGAAAAGGACGCGTATCG...

CDS

Download CDS FASTA

1200 bp · TkA06G008600|TK1151|CDS

CCACGGCAACGGAAAGCCGAAAACCAGAGTTGGCCCAAAGGGGCTTTTCCGGGACAATTAGGGCACAGCTTATCCACTCGCACCATCGAGACCACTCTCCAGTCTCCCCTGAGGATTAGCGTTCTCGTGAAAGGAAAGAAAGAGGTCATGTCTGTTGATAATTCTGTAGTTGATTCCTCAGTGACTGATTGGAAGCCTGATGTAGAGAATAAGAACAACCAAGAAAGCCAAAATGACAAAGTAGAAAAGGACGCGTATCG...

Protein

Download Protein FASTA

399 aa · TkA06G008600|TK1151|PROTEIN

PRQRKAENQSWPKGAFPGQLGHSLSTRTIETTLQSPLRISVLVKGKKEVMSVDNSVVDSSVTDWKPDVENKNNQESQNDKVEKDAYRSGAEDQDHSCEQVGTSNANKRNKPSDTRYFIIKSLNHDNIQLSIQRGIWATQVMNEPILEEAYHNSGKVILIFSVNMSGFFQGYAQMMSSVGWRRDNVWSHGHGGSKPWGRSFKVKWLRLHDLPFQKTLHLKNPLNQFKPVKISRDCQELPQDIGEALCELIDGENGIDENQT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G008600`
TK1151 ID	TkA06G008600
OH-1004 ID	LXL04_026500
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.400
Protein coverage (%)	TK1151 88.722 / OH-1004 74.526 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G008600

Location Chr06:2163732-2166483 (-)

Description Similar to CPSF30: 30-kDa cleavage and polyadenylation specificity factor 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30460`	Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation.	Calmodulin interacts with and regulates the RNA-binding activity of an Arabidopsis polyadenylation factor subunit.2006 · DOI: 10.1104/pp.105.070672 A novel endonuclease activity associated with the Arabidopsis ortholog of the 30-kDa subunit of cleavage and polyadenylation specificity factor.2007 · DOI: 10.1093/nar/gkm457 A polyadenylation factor subunit implicated in regulating oxidative signaling in Arabidopsis thaliana.2008 · DOI: 10.1371/journal.pone.0002410 The Arabidopsis ortholog of the 77 kDa subunit of the cleavage stimulatory factor (AtCstF-77) involved in mRNA polyadenylation is an RNA-binding protein.2010 · DOI: 10.1016/j.febslet.2010.03.007 Genome-wide control of polyadenylation site choice by CPSF30 in Arabidopsis.2012 · DOI: 10.1105/tpc.112.096107 The Polyadenylation Factor Subunit CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR30: A Key Factor of Programmed Cell Death and a Regulator of Immunity in Arabidopsis.2014 · DOI: 10.1104/pp.114.236083

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0677700`	Zinc finger CCCH domain-containing protein 45.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026500 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006376 mRNA splice site recognition Biological Process

GO:0006396 RNA processing Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010608 post-transcriptional regulation of gene expression Biological Process

GO:0031124 mRNA 3'-end processing Biological Process

GO:0031440 regulation of mRNA 3'-end processing Biological Process

GO:0034052 positive regulation of plant-type hypersensitive response Biological Process

KEGG gene cross-reference

ath:AT1G30460

dosa:Os06g0677700

hsa:91746

mmu:231386

rno:170956

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.751

Rank 1 · TkA06G008600 · TK1151

Cytoplasm0.319

Rank 2 · TkA06G008600 · TK1151

Cell membrane0.049

Rank 3 · TkA06G008600 · TK1151

Mitochondrion0.040

Rank 4 · TkA06G008600 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkA06G008600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04146YTH114-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G008600	`PF04146`	YTH	114	249	4.5e-49	166.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A9LNK9`	Arabidopsis thaliana	sp\|A9LNK9\|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30	51.500%	Swiss-Prot	Low
`Q0DA50`	Oryza sativa subsp. japonica	sp\|Q0DA50\|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45	51.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card