TkA06G006980 | RubberDandelionOmics

Gene overview

TkA06G006980

Reference: TK1151 Chr: Chr06 Coordinates: 1796529-1797980 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1266 bp · TkA06G006980|TK1151|cDNA

ATGGAAGAAGAAATCTCCCACCGCCCACCGGAGAAACTTCTCAGAGCGGCGGTATCGGAGCTAAAAATACAGCAAGCGATTGCATGTCCATTGATGGCGATGAACTTGACATGGTTTGCCAAGATAGCCATCACCACAGCGTTTCTCGGTCGGCTGGGTGAGCTTGAGTTAGCCAGTGGTGCTCTCGGGTTCATGTTTGCAAACGTCACTGGTTTCTCGGTCTTAAACGGTCTATGTGGTGCCATGGAGCCTATCTGCGG...

CDS

Download CDS FASTA

1266 bp · TkA06G006980|TK1151|CDS

ATGGAAGAAGAAATCTCCCACCGCCCACCGGAGAAACTTCTCAGAGCGGCGGTATCGGAGCTAAAAATACAGCAAGCGATTGCATGTCCATTGATGGCGATGAACTTGACATGGTTTGCCAAGATAGCCATCACCACAGCGTTTCTCGGTCGGCTGGGTGAGCTTGAGTTAGCCAGTGGTGCTCTCGGGTTCATGTTTGCAAACGTCACTGGTTTCTCGGTCTTAAACGGTCTATGTGGTGCCATGGAGCCTATCTGCGG...

Protein

Download Protein FASTA

421 aa · TkA06G006980|TK1151|PROTEIN

MEEEISHRPPEKLLRAAVSELKIQQAIACPLMAMNLTWFAKIAITTAFLGRLGELELASGALGFMFANVTGFSVLNGLCGAMEPICGQAYGAKNFKLLHKTLVMMSVTIPIMFTSALAVVLHVPVNIFLVKTRGFEGVAMAIWVTDLMVVVMLAVYVAVTEIKKGGTWKEGGWSDQTLQDWVRLLKLSGPCCLTTCLEWWCYEILVLLTGKLPNAKQAVGIIAIVLNFDYLLFSVMLSIATCASIRVSNELGGDRAGHAY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G006980`
TK1151 ID	TkA06G006980
OH-1004 ID	LXL04_026521
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G006980

Location Chr06:1796529-1797980 (-)

Description Similar to DTX56: Protein DETOXIFICATION 56

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22790`	May act as an HCO₃⁻-sensing component in guard-cell CO₂ signaling.	A molecular pathway for CO₂ response in Arabidopsis guard cells.2015 · DOI: 10.1038/ncomms7057
`At4g29140`	Functions as a multidrug and toxin extrusion transporter that negatively regulates plant disease resistance.	ADP1 affects plant architecture by regulating local auxin biosynthesis.2014 · DOI: 10.1371/journal.pgen.1003954 A subgroup of MATE transporter genes regulates hypocotyl cell elongation in Arabidopsis.2015 · DOI: 10.1093/jxb/erv344
`At1g71870`	May function as a multidrug and toxin extrusion transporter in the export of IAA-conjugates from the cytoplasm into peroxisomes.	No verified direct reference in this release
`At1g58340`	Functions as a multidrug and toxin extrusion transporter.	A Golgi-localized MATE transporter mediates iron homoeostasis under osmotic stress in Arabidopsis.2012 · DOI: 10.1042/bj20111311 A subgroup of MATE transporter genes regulates hypocotyl cell elongation in Arabidopsis.2015 · DOI: 10.1093/jxb/erv344
`At4g23030`	Protein DETOXIFICATION 49.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026521 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010600 regulation of auxin biosynthetic process Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0046620 regulation of organ growth Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0071244 cellular response to carbon dioxide Biological Process

GO:0080168 abscisic acid transport Biological Process

GO:1902456 regulation of stomatal opening Biological Process

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

KEGG gene cross-reference

ath:AT1G71870

ath:AT4G22790

ath:AT4G29140

ath:AT5G19700

ath:AT5G52050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.639

Rank 1 · TkA06G006980 · TK1151

Lysosome / Vacuole0.147

Rank 2 · TkA06G006980 · TK1151

Endoplasmic reticulum0.111

Rank 3 · TkA06G006980 · TK1151

Cytoplasm0.076

Rank 4 · TkA06G006980 · TK1151

Golgi apparatus0.049

Rank 5 · TkA06G006980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554MatE30-121 aa

PF01554MatE110-160 aa

PF06143Baculo_11_kDa147-158 aa

PF01554MatE190-352 aa

PF06143Baculo_11_kDa222-241 aa

PF01554MatE363-381 aa

PF06143Baculo_11_kDa371-399 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G006980	`PF01554`	MatE	30	121	3.8e-37	128.2
TkA06G006980	`PF01554`	MatE	110	160	3.8e-37	128.2
TkA06G006980	`PF06143`	Baculo_11_kDa	147	158	1.3	9.4
TkA06G006980	`PF01554`	MatE	190	352	3.8e-37	128.2
TkA06G006980	`PF06143`	Baculo_11_kDa	222	241	1.3	9.4
TkA06G006980	`PF01554`	MatE	363	381	3.8e-37	128.2
TkA06G006980	`PF06143`	Baculo_11_kDa	371	399	1.3	9.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49660`	Arabidopsis thaliana	sp\|O49660\|DTX56_ARATH Protein DETOXIFICATION 56	52.900%	Swiss-Prot	High
`Q9SZE2`	Arabidopsis thaliana	sp\|Q9SZE2\|DTX51_ARATH Protein DETOXIFICATION 51	33.100%	Swiss-Prot	Medium
`Q9LE20`	Arabidopsis thaliana	sp\|Q9LE20\|DTX54_ARATH Protein DETOXIFICATION 54	32.600%	Swiss-Prot	Medium
`Q9SLV0`	Arabidopsis thaliana	sp\|Q9SLV0\|DTX48_ARATH Protein DETOXIFICATION 48	32.200%	Swiss-Prot	Medium
`O82752`	Arabidopsis thaliana	sp\|O82752\|DTX49_ARATH Protein DETOXIFICATION 49	31.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card