TkA06G006720 | RubberDandelionOmics

Gene overview

TkA06G006720

Reference: TK1151 Chr: Chr06 Coordinates: 1743889-1747666 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

897 bp · TkA06G006720|TK1151|cDNA

ATGGTTTCCCCTCCTCCACCGCCGATCGCCGACATCACTGCTTCTCCTTCCTTTCCCCGTTGTTGGTACCCTCCTCCACCGTCGCTAGGCTACGTCGGAGGTAATTTCGGTCGATTTTTGTTCAGTTTAATGTGTCTCGTTCAAAGCTCCTCCACCATCGCTAGCCGTTCAACATCTTCGGGCTTCTCCAACATCTTTCCACACTCAAGCAGAGATGCCAGGGCCAACAATGGAGTTGGAGCTACCAGTAAATGGAAGAA...

CDS

Download CDS FASTA

897 bp · TkA06G006720|TK1151|CDS

ATGGTTTCCCCTCCTCCACCGCCGATCGCCGACATCACTGCTTCTCCTTCCTTTCCCCGTTGTTGGTACCCTCCTCCACCGTCGCTAGGCTACGTCGGAGGTAATTTCGGTCGATTTTTGTTCAGTTTAATGTGTCTCGTTCAAAGCTCCTCCACCATCGCTAGCCGTTCAACATCTTCGGGCTTCTCCAACATCTTTCCACACTCAAGCAGAGATGCCAGGGCCAACAATGGAGTTGGAGCTACCAGTAAATGGAAGAA...

Protein

Download Protein FASTA

298 aa · TkA06G006720|TK1151|PROTEIN

MVSPPPPPIADITASPSFPRCWYPPPPSLGYVGGNFGRFLFSLMCLVQSSSTIASRSTSSGFSNIFPHSSRDARANNGVGATSKWKNIQKDREFNHFLYSRSNIDLKDKWRNMSVSANGQGIFNNSSTSALVAQDLNAVALHGGRTQSEREGAFRDFRHGPTNILVATDVASRGLNVTGVAHVVNLDLPKVGISSGAAAAAAIKVGKRPENAGKLIAWHGQLRSILGWLYSFLLDALFRNDNSTLAQIIPNVNVAPFRPF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G006720`
TK1151 ID	TkA06G006720
OH-1004 ID	LXL04_026523
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	81.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G006720

Location Chr06:1743889-1747666 (+)

Description Similar to Os06g0602400: DEAD-box ATP-dependent RNA helicase 52A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0602400`	DEAD-box ATP-dependent RNA helicase 52A.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026523 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0000380 alternative mRNA splicing, via spliceosome Biological Process

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0002376 immune system process Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006417 regulation of translation Biological Process

GO:0006535 L-cysteine biosynthetic process from L-serine Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing Biological Process

GO:0050688 regulation of defense response to virus Biological Process

KEGG gene cross-reference

dme:Dmel_CG10279

dosa:Os03g0805200

dosa:Os06g0602400

pgu:PGUG_04031

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.266

Rank 1 · TkA06G006720 · TK1151

Nucleus0.256

Rank 2 · TkA06G006720 · TK1151

Cytoplasm0.213

Rank 3 · TkA06G006720 · TK1151

Mitochondrion0.153

Rank 4 · TkA06G006720 · TK1151

Endoplasmic reticulum0.086

Rank 5 · TkA06G006720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00271Helicase_C133-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G006720	`PF00271`	Helicase_C	133	190	3.8e-16	60.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0DB53`	Oryza sativa subsp. japonica	sp\|Q0DB53\|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A	61.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card