TkA06G005400 | RubberDandelionOmics

Gene overview

TkA06G005400

Reference: TK1151 Chr: Chr06 Coordinates: 1380771-1381540 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

513 bp · TkA06G005400|TK1151|cDNA

ATGATATCAAATTGCTGGTTGTCGGAAGTTACCAGAGAGAAATACGACATCAGCCTTGCATCCCTCGCTTTTTCACTCATCACGTTGGCTATTTTATGGTACAAGTTTGGGAAGGCTACACCGCCAGGACCTCGTGGGTTGCCGCTACAAAAAGAACTTGGAAGCTTCTCGATCTTTCCGGCGAGGTGGGGTAAGAGAAGCCGTCAAGCATGTTGTGGGGAAACTATAGGAAGTGAGGTGGACATCGGGACGATCGCGTT...

CDS

Download CDS FASTA

513 bp · TkA06G005400|TK1151|CDS

ATGATATCAAATTGCTGGTTGTCGGAAGTTACCAGAGAGAAATACGACATCAGCCTTGCATCCCTCGCTTTTTCACTCATCACGTTGGCTATTTTATGGTACAAGTTTGGGAAGGCTACACCGCCAGGACCTCGTGGGTTGCCGCTACAAAAAGAACTTGGAAGCTTCTCGATCTTTCCGGCGAGGTGGGGTAAGAGAAGCCGTCAAGCATGTTGTGGGGAAACTATAGGAAGTGAGGTGGACATCGGGACGATCGCGTT...

Protein

Download Protein FASTA

170 aa · TkA06G005400|TK1151|PROTEIN

MISNCWLSEVTREKYDISLASLAFSLITLAILWYKFGKATPPGPRGLPLQKELGSFSIFPARWGKRSRQACCGETIGSEVDIGTIAFSTSLSVITSMLWGKSLVEYENHSKLGGTDTTSTMAEWTMAELLRNPDVLKKIQEELEQVVGLNHMVEESHLPRRVFWEYWECW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G005400`
TK1151 ID	TkA06G005400
OH-1004 ID	LXL04_026549
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	60.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G005400

Location Chr06:1380771-1381540 (+)

Description Similar to CYP76C1: Cytochrome P450 76C1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20110`	Cytochrome P450 705A20.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0317900`	Catalyzes the 3'-hydroxylation of the flavonoid B-ring to the 3',4'-hydroxylated state.	Completion of Tricin Biosynthesis Pathway in Rice: Cytochrome P450 75B4 Is a Unique Chrysoeriol 5'-Hydroxylase.2015 · DOI: 10.1104/pp.15.00566

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026549 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016102 diterpenoid biosynthetic process Biological Process

GO:0033075 isoquinoline alkaloid biosynthetic process Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0016712 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen Molecular Function

GO:0020037 heme binding Molecular Function

GO:0050593 N-methylcoclaurine 3'-monooxygenase activity Molecular Function

KEGG gene cross-reference

ag:AAC39452

ag:AGN04215

ath:AT2G45560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.853

Rank 1 · TkA06G005400 · TK1151

Cytoplasm0.060

Rank 2 · TkA06G005400 · TK1151

Nucleus0.044

Rank 3 · TkA06G005400 · TK1151

Lysosome / Vacuole0.039

Rank 4 · TkA06G005400 · TK1151

Golgi apparatus0.035

Rank 5 · TkA06G005400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45076-108 aa

PF00067p450113-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G005400	`PF00067`	p450	76	108	2.4e-10	40.5
TkA06G005400	`PF00067`	p450	113	158	2.4e-10	40.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJY7`	Arabidopsis thaliana	sp\|Q9LJY7\|C75AK_ARATH Cytochrome P450 705A20	49.000%	Swiss-Prot	Low
`Q8LM92`	Oryza sativa subsp. japonica	sp\|Q8LM92\|C75B4_ORYSJ Flavonoid 3'-monooxygenase CYP75B4	57.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card