TkA06G001040 | RubberDandelionOmics

Gene overview

TkA06G001040

Reference: TK1151 Chr: Chr06 Coordinates: 234013-234555 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

464 bp · TkA06G001040|TK1151|cDNA

CTCCCTCTCTTTCTTCGGTTCTTTACATACCTTCCTATCGCTACAATCGGTGACCTAAATATCCGGTCAGAAATCGATCATCGGATTCCGGCAGTAGTAGTTTTTTCCGTTTCCCCCTTCGACCCACTTGAAATCACCGATAATTCTGAAGATCTTTTTCGTTGTCTAATCGGAGATTCTGGAGTTGGCAAACCAAATCTGTTGTCTAGATTCACTCGCAATGAGTTCAGTCTTGAGTCAAATTTACCATCGGCGTTGAA...

CDS

Download CDS FASTA

426 bp · TkA06G001040|TK1151|CDS

CTCCCTCTCTTTCTTCGGTTCTTTACATACCTTCCTATCGCTACAATCGGTGACCTAAATATCCGGTCAGAAATCGATCATCGGATTCCGGCAGTAGTAGTTTTTTCCGTTTCCCCCTTCGACCCACTTGAAATCACCGATAATTCTGAAGATCTTTTTCGTTGTCTAATCGGAGATTCTGGAGTTGGCAAACCAAATCTGTTGTCTAGATTCACTCGCAATGAGTTCAGTCTTGAGTCAAATTTACCATCGGCGTTGAA...

Protein

Download Protein FASTA

141 aa · TkA06G001040|TK1151|PROTEIN

LPLFLRFFTYLPIATIGDLNIRSEIDHRIPAVVVFSVSPFDPLEITDNSEDLFRCLIGDSGVGKPNLLSRFTRNEFSLESNLPSALNSPPVPFMLRIKLSRLRFGTPLSRKCNCQISLTAISSISYIILEINCLCMIWVLN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G001040`
TK1151 ID	TkA06G001040
OH-1004 ID	LXL04_012755
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.700
Protein coverage (%)	TK1151 56.028 / OH-1004 59.848 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G001040

Location Chr06:234013-234555 (+)

Description Similar to RRM1: Ribonucleoside-diphosphate reductase large subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18800`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At5g60860`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At4g18430`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0551400`	Possesses GTPase activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012755 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000731 DNA synthesis involved in DNA repair Biological Process

GO:0006235 dTTP biosynthetic process Biological Process

GO:0006240 dCDP biosynthetic process Biological Process

GO:0006260 DNA replication Biological Process

GO:0006264 mitochondrial DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0009185 ribonucleoside diphosphate metabolic process Biological Process

GO:0009202 deoxyribonucleoside triphosphate biosynthetic process Biological Process

GO:0009263 deoxyribonucleotide biosynthetic process Biological Process

GO:0009265 2'-deoxyribonucleotide biosynthetic process Biological Process

GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0046704 CDP metabolic process Biological Process

KEGG gene cross-reference

ath:AT2G21790

hsa:6240

mmu:20133

pon:100172956

spo:2541695

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.407

Rank 1 · TkA06G001040 · TK1151

Nucleus0.352

Rank 2 · TkA06G001040 · TK1151

Mitochondrion0.189

Rank 3 · TkA06G001040 · TK1151

Cell membrane0.075

Rank 4 · TkA06G001040 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA06G001040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03193RsgA_GTPase44-73 aa

PF08477Roc55-80 aa

PF00071Ras56-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G001040	`PF03193`	RsgA_GTPase	44	73	0.24	11.9
TkA06G001040	`PF08477`	Roc	55	80	0.0018	19.2
TkA06G001040	`PF00071`	Ras	56	79	0.00049	20.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SN35`	Arabidopsis thaliana	sp\|Q9SN35\|RAA1D_ARATH Ras-related protein RABA1d	77.100%	Swiss-Prot	Low
`Q9FJH0`	Arabidopsis thaliana	sp\|Q9FJH0\|RAA1F_ARATH Ras-related protein RABA1f	77.100%	Swiss-Prot	Low
`O49513`	Arabidopsis thaliana	sp\|O49513\|RAA1E_ARATH Ras-related protein RABA1e	74.300%	Swiss-Prot	Low
`P40393`	Oryza sativa subsp. japonica	sp\|P40393\|RIC2_ORYSJ Ras-related protein RIC2	77.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card