TkA05G472550 | RubberDandelionOmics

Gene overview

TkA05G472550

Reference: TK1151 Chr: Chr05 Coordinates: 118587781-118590655 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1702 bp · TkA05G472550|TK1151|cDNA

ATATAGTTTCCTTTACATGTCCCAATTAAATGGATGTTAAAGGTGAAGGTTTCTCAGTGAAGGTCATAAAGACAGAAGTGGTTGCACCAAAACAACTATGGCATGACCACTGGTTACCCCTCACGAACCTAGATTTGCTGGTGCCACCATTTGATGTGGGTTCGTTCTTCTGTTACAAAAAATCCCATGAGAGTGACGATATCACCACCATACTTGATGCTCTCAAGACATCCTTATCACAAGCACTGGCCTTGTTCTAT...

CDS

Download CDS FASTA

1395 bp · TkA05G472550|TK1151|CDS

ATGGATGTTAAAGGTGAAGGTTTCTCAGTGAAGGTCATAAAGACAGAAGTGGTTGCACCAAAACAACTATGGCATGACCACTGGTTACCCCTCACGAACCTAGATTTGCTGGTGCCACCATTTGATGTGGGTTCGTTCTTCTGTTACAAAAAATCCCATGAGAGTGACGATATCACCACCATACTTGATGCTCTCAAGACATCCTTATCACAAGCACTGGCCTTGTTCTATCCACTCGCCGGAGAGATTGTCCGCACCAC...

Protein

Download Protein FASTA

464 aa · TkA05G472550|TK1151|PROTEIN

MDVKGEGFSVKVIKTEVVAPKQLWHDHWLPLTNLDLLVPPFDVGSFFCYKKSHESDDITTILDALKTSLSQALALFYPLAGEIVRTTAGEPEIHCNNKGVDFTEASADVELWDLNFYNPNECMEGKLMPKRHHGVLAIQVTMLKCGGMVIACMFDHRVADGYSANMFVSSWADMTRSDPPSFLPSFRRSILNARRPTVYSTSVSNVFLPLSHLPSLDIDPTTESELNQDSLLNRIYYVEGDQLKRLQVLASENGCRRSKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G472550`
TK1151 ID	TkA05G472550
OH-1004 ID	LXL04_022505
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G472550

Location Chr05:118587781-118590655 (+)

Description Similar to HST: Shikimate O-hydroxycinnamoyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47980`	Probably involved in the modification of desaturated thalian-diol.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0185500`	Hydroxycinnamoyl transferase that catalyzes in vitro the transfer of an acyl from p-coumaryol-CoA to glycerol or shikimate, to produce 2-O-p-coumaroyl glyceride or coumaroyl shikimate, respectively.	Characterization of hydroxycinnamoyltransferase from rice and its application for biological synthesis of hydroxycinnamoyl glycerols.2012 · DOI: 10.1016/j.phytochem.2011.12.015
`Os06g0185300`	Hydroxycinnamoyl transferase that catalyzes the transfer of an acyl from p-coumaryol-CoA to putrescine, to produce coumaroyl putrescine.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022505 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007623 circadian rhythm Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ag:ABG75942

ath:AT5G41040

ath:AT5G48930

nta:107796658

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.602

Rank 1 · TkA05G472550 · TK1151

Nucleus0.310

Rank 2 · TkA05G472550 · TK1151

Endoplasmic reticulum0.110

Rank 3 · TkA05G472550 · TK1151

Cell membrane0.093

Rank 4 · TkA05G472550 · TK1151

Plastid0.062

Rank 5 · TkA05G472550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458Transferase9-452 aa

PF22664TRI-like_N47-90 aa

PF001982-oxoacid_dh148-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G472550	`PF02458`	Transferase	9	452	5e-91	306.3
TkA05G472550	`PF22664`	TRI-like_N	47	90	0.0035	17.8
TkA05G472550	`PF00198`	2-oxoacid_dh	148	174	0.12	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI40`	Arabidopsis thaliana	sp\|Q9FI40\|BAHD1_ARATH BAHD acyltransferase At5g47980	24.900%	Swiss-Prot	Low
`Q5SMM6`	Oryza sativa subsp. japonica	sp\|Q5SMM6\|HCT4_ORYSJ Hydroxycinnamoyltransferase 4	32.600%	Swiss-Prot	Low
`Q5SMQ0`	Oryza sativa subsp. japonica	sp\|Q5SMQ0\|PHT2_ORYSJ Putrescine hydroxycinnamoyltransferase 2	31.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card