TkA05G470960 | RubberDandelionOmics

Gene overview

TkA05G470960

Reference: TK1151 Chr: Chr05 Coordinates: 118222450-118224871 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1154 bp · TkA05G470960|TK1151|cDNA

TTCTATTCTGCCAAAAAAGCGTGCTCCTTCTTCTCATTTCTATTTCACGACACTGCCTCCTTTCCGTCCCAGCACTCTCGGACAACGTGCAGCCCTCCGCCGTTGCTCTAGCCACCTGCCGGTCACCGCCTCCTCCCGCAACGCCCTCTAGTTCTGTCAAACTCGTCGACAACAGCATCAGATTTGAAAGAGGATAGAAAGATGGCAGCTTTTACATTGCCTCAAAACTCTTCCATTAAGCTAAGATCTTCATTGTACCT...

CDS

Download CDS FASTA

477 bp · TkA05G470960|TK1151|CDS

ATGCAATCAAACAAAGCCATTGTTCCAAGAATACGCCACGTCATCTCCAACAAAGACTCATCAAATTCAGTGGGTGTCTTGGTGAAAAACAACAACCCTGTAATTGTGATTGACAATTATGACAGCTTCACTTACAACCTTTGCCAGTACATGGGAGAATTGGGATGCAACTTTGAGGTTTACAGAAATGATGAGCTTACAGTGGACGAATTAAAAAAAAAAAATCCAAGAGGAATTCTTATATCTCCTGGCCCAGGTAC...

Protein

Download Protein FASTA

158 aa · TkA05G470960|TK1151|PROTEIN

MQSNKAIVPRIRHVISNKDSSNSVGVLVKNNNPVIVIDNYDSFTYNLCQYMGELGCNFEVYRNDELTVDELKKKNPRGILISPGPGTPQDSGISLQTVLELGPDVPLFGVCMGLQCIGEAFGGKLFDLLMVLCMEKAHWFIIMKAGKIVYFQAYQTRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G470960`
TK1151 ID	TkA05G470960
OH-1004 ID	LXL04_023126
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	42.400
Protein coverage (%)	TK1151 56.962 / OH-1004 11.290 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G470960

Location Chr05:118222450-118224871 (+)

Description Similar to ADCS: Aminodeoxychorismate synthase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25220`	Part of a heterotetrameric complex that catalyzes the two- step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	A Link between ethylene and auxin uncovered by the characterization of two root-specific ethylene-insensitive mutants in Arabidopsis.2005 · DOI: 10.1105/tpc.105.033365
`At5g57890`	Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0463500`	Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	In vitro reconstitution of rice anthranilate synthase: distinct functional properties of the alpha subunits OASA1 and OASA2.2004 · DOI: 10.1023/b:plan.0000028729.79034.07
`Os03g0718000`	Part of a heterotetrameric complex that catalyzes the two- step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	In vitro reconstitution of rice anthranilate synthase: distinct functional properties of the alpha subunits OASA1 and OASA2.2004 · DOI: 10.1023/b:plan.0000028729.79034.07

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023126 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0008153 4-aminobenzoate biosynthetic process Biological Process

GO:0009396 folic acid-containing compound biosynthetic process Biological Process

GO:0017000 antibiotic biosynthetic process Biological Process

GO:0046417 chorismate metabolic process Biological Process

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0046656 folic acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0046820 4-amino-4-deoxychorismate synthase activity Molecular Function

KEGG gene cross-reference

ath:AT2G28880

dosa:Os06g0699700

sly:543912

sve:SVEN_0920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.562

Rank 1 · TkA05G470960 · TK1151

Nucleus0.361

Rank 2 · TkA05G470960 · TK1151

Mitochondrion0.170

Rank 3 · TkA05G470960 · TK1151

Peroxisome0.063

Rank 4 · TkA05G470960 · TK1151

Cell membrane0.059

Rank 5 · TkA05G470960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00117GATase36-126 aa

PF07722Peptidase_C26103-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G470960	`PF00117`	GATase	36	126	4.7e-28	98.9
TkA05G470960	`PF07722`	Peptidase_C26	103	128	0.00087	19.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42565`	Arabidopsis thaliana	sp\|Q42565\|ASB1_ARATH Anthranilate synthase beta subunit 1, chloroplastic	84.400%	Swiss-Prot	Medium
`Q9FJM5`	Arabidopsis thaliana	sp\|Q9FJM5\|ASB2_ARATH Anthranilate synthase beta subunit 2, chloroplastic	84.900%	Swiss-Prot	Medium
`Q7XUS2`	Oryza sativa subsp. japonica	sp\|Q7XUS2\|ASB1_ORYSJ Anthranilate synthase beta subunit 1, chloroplastic	87.100%	Swiss-Prot	Medium
`Q764B9`	Oryza sativa subsp. japonica	sp\|Q764B9\|ASB2_ORYSJ Anthranilate synthase beta subunit 2, chloroplastic	71.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card