RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G468590
Reference: TK1151 Chr: Chr05 Coordinates: 117376535-117378770 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1488 bp · TkA05G468590|TK1151|cDNA

ATGGATCTGTTCAAGAGTCTTGGAAGCATTGAAAATGCAGAACAAAAAGAACTTGAGGATCATGTTGATTTCATTTTAAATTATTTTGGTGTGAGGAAACAATGTGTAAATGGCAACATTGTTTACTTGTTAGTCAACAAGGATTTTGATTGGGTGAGAAATGCTGGTTTTTGGAAAGATGGATTCAATGATGGTTATGTTGCTCCAGCACTCCAGAATGCTCTAGAAGATACTCATAGAGCCTACTGGTGGCTTCCTGG...

CDS

Download CDS FASTA

1488 bp · TkA05G468590|TK1151|CDS

ATGGATCTGTTCAAGAGTCTTGGAAGCATTGAAAATGCAGAACAAAAAGAACTTGAGGATCATGTTGATTTCATTTTAAATTATTTTGGTGTGAGGAAACAATGTGTAAATGGCAACATTGTTTACTTGTTAGTCAACAAGGATTTTGATTGGGTGAGAAATGCTGGTTTTTGGAAAGATGGATTCAATGATGGTTATGTTGCTCCAGCACTCCAGAATGCTCTAGAAGATACTCATAGAGCCTACTGGTGGCTTCCTGG...

Protein

Download Protein FASTA

495 aa · TkA05G468590|TK1151|PROTEIN

MDLFKSLGSIENAEQKELEDHVDFILNYFGVRKQCVNGNIVYLLVNKDFDWVRNAGFWKDGFNDGYVAPALQNALEDTHRAYWWLPGFMSPHSFVYLMDRLLLMASFSSGVFFTTKSSFLGWYSCTSNPDTDLSASKQIFSKDIAYYLVGMIQNILYKKDETISWIERSNIVALYYHPLMVLKLLMMVSLIHIQLLDCSQVVIDLLLGWNNVSYLLPPKFVGDLLRRTNGCELNLVPDMVAEAFASIGDPLVIVSLENGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G468590
TK1151 IDTkA05G468590
OH-1004 IDLXL04_022441
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)67.500
Protein coverage (%)TK1151 98.586 / OH-1004 21.436
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G468590
LocationChr05:117376535-117378770 (+)
DescriptionSimilar to TRANK1: TPR and ankyrin repeat-containing protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022441 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006283 transcription-coupled nucleotide-excision repair Biological Process
GO:0006353 DNA-templated transcription termination Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0006364 rRNA processing Biological Process
GO:0006369 termination of RNA polymerase II transcription Biological Process
GO:0006386 termination of RNA polymerase III transcription Biological Process
GO:0006399 tRNA metabolic process Biological Process
GO:0006974 DNA damage response Biological Process
GO:0008033 tRNA processing Biological Process
GO:0009553 embryo sac development Biological Process
GO:0009875 pollen-pistil interaction Biological Process
GO:0010183 pollen tube guidance Biological Process
KEGG gene cross-reference
ath:AT4G15570
hsa:9881
mmu:320429
sce:YLR430W
spo:2540523
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.444
Rank 1 · TkA05G468590 · TK1151
Cytoplasm0.382
Rank 2 · TkA05G468590 · TK1151
Cell membrane0.153
Rank 3 · TkA05G468590 · TK1151
Endoplasmic reticulum0.084
Rank 4 · TkA05G468590 · TK1151
Golgi apparatus0.063
Rank 5 · TkA05G468590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser