TkA05G468300 | RubberDandelionOmics

Gene overview

TkA05G468300

Reference: TK1151 Chr: Chr05 Coordinates: 117314975-117315361 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · TkA05G468300|TK1151|cDNA

ATGCTGCTCTCAGTATTTCTCGCCCTCTTCCTCCCCTGTGCCGGCATGAGCGCTGTCTTCCTCATCTACATTTGCTTGCTCTGCTACGCCGCCCGCCACTACCATCCTGATGATCCGGTAAAACCCGCCACCGAAGAAGGTCTATCTTCCAACCAGCTCGCCAGATTGCCGACCACCATGGGGAAGGACCTGGTATTGGGGACGGAATGCGCCGTCTGCCTTGACGATATCGAGCCGGAGCAACGTGCTCGGATGTTTCC...

CDS

Download CDS FASTA

387 bp · TkA05G468300|TK1151|CDS

ATGCTGCTCTCAGTATTTCTCGCCCTCTTCCTCCCCTGTGCCGGCATGAGCGCTGTCTTCCTCATCTACATTTGCTTGCTCTGCTACGCCGCCCGCCACTACCATCCTGATGATCCGGTAAAACCCGCCACCGAAGAAGGTCTATCTTCCAACCAGCTCGCCAGATTGCCGACCACCATGGGGAAGGACCTGGTATTGGGGACGGAATGCGCCGTCTGCCTTGACGATATCGAGCCGGAGCAACGTGCTCGGATGTTTCC...

Protein

Download Protein FASTA

128 aa · TkA05G468300|TK1151|PROTEIN

MLLSVFLALFLPCAGMSAVFLIYICLLCYAARHYHPDDPVKPATEEGLSSNQLARLPTTMGKDLVLGTECAVCLDDIEPEQRARMFPGCNHGFHVQCADTWLSKNPVCPVCRNKLDADFFVPPEANPC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G468300`
TK1151 ID	TkA05G468300
OH-1004 ID	LXL04_022299
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G468300

Location Chr05:117314975-117315361 (+)

Description Similar to ATL23: E3 ubiquitin-protein ligase ATL23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42200`	E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8, UBC10, UBC11, UBC28 and UBC29 in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022299 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0048481 plant ovule development Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0016020 membrane Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G72220

ath:AT2G42350

ath:AT3G10910

ath:AT5G05810

ath:AT5G42200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.258

Rank 1 · TkA05G468300 · TK1151

Endoplasmic reticulum0.250

Rank 2 · TkA05G468300 · TK1151

Cell membrane0.245

Rank 3 · TkA05G468300 · TK1151

Golgi apparatus0.239

Rank 4 · TkA05G468300 · TK1151

Cytoplasm0.217

Rank 5 · TkA05G468300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13920zf-C3HC4_39-14 aa

PF17123zf-RING_1110-13 aa

PF14446Prok-RING_122-33 aa

PF17120zf-RING_1623-29 aa

PF23413zf_RING_Vps8_fungal23-29 aa

PF13920zf-C3HC4_324-31 aa

PF14634zf-RING_524-29 aa

PF14447Prok-RING_424-33 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G468300	`PF13920`	zf-C3HC4_3	9	14	1.2e-05	25.8
TkA05G468300	`PF17123`	zf-RING_11	10	13	7.1e-11	42.3
TkA05G468300	`PF14446`	Prok-RING_1	22	33	0.63	11.0
TkA05G468300	`PF17120`	zf-RING_16	23	29	0.0021	18.3
TkA05G468300	`PF23413`	zf_RING_Vps8_fungal	23	29	0.019	15.0
TkA05G468300	`PF13920`	zf-C3HC4_3	24	31	1.2e-05	25.8
TkA05G468300	`PF14634`	zf-RING_5	24	29	2.8e-05	24.7
TkA05G468300	`PF14447`	Prok-RING_4	24	33	0.025	15.2
TkA05G468300	`PF10367`	zf-Vps39_C	24	28	0.88	9.9
TkA05G468300	`PF13639`	zf-RING_2	25	29	1.4e-13	51.5
TkA05G468300	`PF13923`	zf-C3HC4_2	25	29	8e-08	32.7
TkA05G468300	`PF13445`	zf-RING_UBOX	25	28	0.0043	17.7
TkA05G468300	`PF24921`	RING_XB3-XBAT31	25	30	0.15	12.8
TkA05G468300	`PF00628`	PHD	25	33	1.2	10.0
TkA05G468300	`PF11793`	FANCL_C	25	32	4.2	8.4
TkA05G468300	`PF08746`	zf-RING-like	27	31	0.03	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L9W3`	Arabidopsis thaliana	sp\|Q8L9W3\|ATL23_ARATH E3 ubiquitin-protein ligase ATL23	53.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card