TkA05G465350 | RubberDandelionOmics

Gene overview

TkA05G465350

Reference: TK1151 Chr: Chr05 Coordinates: 116642615-116643631 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

987 bp · TkA05G465350|TK1151|cDNA

ATGTTCCTGGTCGAGAAAGCTCATTTAACTTCCCATTTTAAATCATTCACCAAGAAATCCTCTTCTAACCACAAAAGCTACCAACTTGCAGCTCGTTCTTTCGATGAAAAGGTAATATTCCATCTGAAAACACTAACACCGGCCTCCGATTCGTCGATTATCAGCTTATCTTGGATGTCGAAGGCTGTTTCATTTCTGTCGATGGTTCACTTCGAAGCGCAAAATCAGATTTCGAATTTGAGATCTGAAACAGATTGTAA...

CDS

Download CDS FASTA

987 bp · TkA05G465350|TK1151|CDS

ATGTTCCTGGTCGAGAAAGCTCATTTAACTTCCCATTTTAAATCATTCACCAAGAAATCCTCTTCTAACCACAAAAGCTACCAACTTGCAGCTCGTTCTTTCGATGAAAAGGTAATATTCCATCTGAAAACACTAACACCGGCCTCCGATTCGTCGATTATCAGCTTATCTTGGATGTCGAAGGCTGTTTCATTTCTGTCGATGGTTCACTTCGAAGCGCAAAATCAGATTTCGAATTTGAGATCTGAAACAGATTGTAA...

Protein

Download Protein FASTA

328 aa · TkA05G465350|TK1151|PROTEIN

MFLVEKAHLTSHFKSFTKKSSSNHKSYQLAARSFDEKVIFHLKTLTPASDSSIISLSWMSKAVSFLSMVHFEAQNQISNLRSETDCNQALYMDYSLKVLDLCNLISSAVQQLTERRLLMNLSLRLIDSTSQIPSADKLKKAKDALIRSVRHTQETSKEKGLRAKALIGELDSAVNSLPLGKTSSAKDLIRRTLHGLGVLTVFVSSVLISVLYGQSDAVEVRVPAEFLWADSVTSVQTQIYELIKPKQIHELDDTANLAAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G465350`
TK1151 ID	TkA05G465350
OH-1004 ID	LXL04_011028
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	52.800
Protein coverage (%)	TK1151 97.866 / OH-1004 99.654 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G465350

Location Chr05:116642615-116643631 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01550`	Required for normal root and shoot development.	BYPASS1 negatively regulates a root-derived signal that controls plant architecture.2004 · DOI: 10.1016/j.cub.2004.09.045 Dissecting the biosynthetic pathway for the bypass1 root-derived signal.2007 · DOI: 10.1111/j.1365-313x.2006.02982.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0513300`	UPF0496 protein 4.	No verified direct reference in this release
`UniProt: A2Z9A6`	UPF0496 protein 4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011028 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.603

Rank 1 · TkA05G465350 · TK1151

Nucleus0.423

Rank 2 · TkA05G465350 · TK1151

Cell membrane0.110

Rank 3 · TkA05G465350 · TK1151

Endoplasmic reticulum0.053

Rank 4 · TkA05G465350 · TK1151

Mitochondrion0.032

Rank 5 · TkA05G465350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05633ROH1-like19-148 aa

PF05633ROH1-like182-321 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G465350	`PF05633`	ROH1-like	19	148	1.7e-16	61.0
TkA05G465350	`PF05633`	ROH1-like	182	321	1.7e-16	61.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMM6`	Arabidopsis thaliana	sp\|Q9LMM6\|BPS1_ARATH Protein BPS1, chloroplastic	26.000%	Swiss-Prot	Low
`Q337C0`	Oryza sativa subsp. japonica	sp\|Q337C0\|U496D_ORYSJ UPF0496 protein 4	31.500%	Swiss-Prot	Medium
`A2Z9A6`	Oryza sativa subsp. indica	sp\|A2Z9A6\|U496D_ORYSI UPF0496 protein 4	30.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card