TkA05G465030 | RubberDandelionOmics

Gene overview

TkA05G465030

Reference: TK1151 Chr: Chr05 Coordinates: 116528180-116542538 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1718 bp · TkA05G465030|TK1151|cDNA

GAAACTTGCTACCTATACATTTATGGTCAAAACCTCTGTGTATATATAGTCATACTATTATTACAATCTGTCAATCAATCATTTCAAAACACACACTCTCACACACACAGTATGAACTTTCTAAGGACTTACAGTTTCCTCCTCATATTTTCTGTATCTATTTTCCGGTGGGGAGTGGCTGTTTCCGACCAGCAGAAGCCAACCGGCCGAGCATTTTTCAAGCAAGAAGCTGACCGAGTTACCCGTCTTCCCGGGCAGCC...

CDS

Download CDS FASTA

1554 bp · TkA05G465030|TK1151|CDS

GAAACTTGCTACCTATACATTTATGGTCAAAACCTCTGTGTATATATAGTCATACTATTATTACAATCTGTCAATCAATCATTTCAAAACACACACTCTCACACACACAGTATGAACTTTCTAAGGACTTACAGTTTCCTCCTCATATTTTCTGTATCTATTTTCCGGTGGGGAGTGGCTGTTTCCGACCAGCAGAAGCCAACCGGCCGAGCATTTTTCAAGCAAGAAGCTGACCGAGTTACCCGTCTTCCCGGGCAGCC...

Protein

Download Protein FASTA

517 aa · TkA05G465030|TK1151|PROTEIN

ETCYLYIYGQNLCVYIVILLLQSVNQSFQNTHSHTHSMNFLRTYSFLLIFSVSIFRWGVAVSDQQKPTGRAFFKQEADRVTRLPGQPPVSFKQYAGYVTVNESHGRALFYWFFEAAESPDKKPLLLWLNGGPGCSSIGFGGLEELGPFVVKKSKSGLLLNDYAWNKAANLLFLESPVGVGFSYTNTSADIKELGDKITAQDSYTFLTKWFRRFPQYKSHDFYIAGESYAGHYAPQLAELIFDTNKVIPDHDRINFKGFMI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G465030`
TK1151 ID	TkA05G465030
OH-1004 ID	LXL04_022404
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.197 / OH-1004 98.583 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G465030

Location Chr05:116528180-116542538 (+)

Description Similar to SCPL34: Serine carboxypeptidase-like 34

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23210`	Probable carboxypeptidase.	No verified direct reference in this release
`At5g08260`	Probable carboxypeptidase.	No verified direct reference in this release
`At4g30610`	Active serine carboxypeptidase with broad substrate preference, including basic and hydrophilic groups.	BRS1, a serine carboxypeptidase, regulates BRI1 signaling in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.091065998 Arabidopsis BRS1 is a secreted and active serine carboxypeptidase.2005 · DOI: 10.1074/jbc.m503299200
`At3g02110`	Probable carboxypeptidase.	No verified direct reference in this release
`At3g17180`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0158500`	Acts as a positive regulator of grain size by controlling grain width, filling and weight.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022404 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G24010

ath:AT4G30610

ath:AT5G08260

ath:AT5G23210

dosa:Os05g0158500

osa:4337873

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.516

Rank 1 · TkA05G465030 · TK1151

Extracellular0.227

Rank 2 · TkA05G465030 · TK1151

Cytoplasm0.109

Rank 3 · TkA05G465030 · TK1151

Endoplasmic reticulum0.094

Rank 4 · TkA05G465030 · TK1151

Cell membrane0.086

Rank 5 · TkA05G465030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450Peptidase_S1084-509 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G465030	`PF00450`	Peptidase_S10	84	509	1.9e-143	479.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WPR4`	Arabidopsis thaliana	sp\|Q0WPR4\|SCP34_ARATH Serine carboxypeptidase-like 34	63.200%	Swiss-Prot	High
`Q9LEY1`	Arabidopsis thaliana	sp\|Q9LEY1\|SCP35_ARATH Serine carboxypeptidase-like 35	52.200%	Swiss-Prot	High
`Q9M099`	Arabidopsis thaliana	sp\|Q9M099\|SCP24_ARATH Serine carboxypeptidase 24	50.700%	Swiss-Prot	High
`Q8L9Y0`	Arabidopsis thaliana	sp\|Q8L9Y0\|SCP25_ARATH Serine carboxypeptidase-like 25	48.100%	Swiss-Prot	Medium
`Q9LSM9`	Arabidopsis thaliana	sp\|Q9LSM9\|SCP33_ARATH Serine carboxypeptidase-like 33	45.600%	Swiss-Prot	Medium
`Q5W727`	Oryza sativa subsp. japonica	sp\|Q5W727\|SCP26_ORYSJ Serine carboxypeptidase-like 26	51.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card