TkA05G464270 | RubberDandelionOmics

Gene overview

TkA05G464270

Reference: TK1151 Chr: Chr05 Coordinates: 116304457-116306493 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1568 bp · TkA05G464270|TK1151|cDNA

TTTACTCAAACAATAAATTAGCCGGTTCTTTAACTTGCAATGGTTGTTTATGATTGTGGGCAAGGCGTCGAATCAATAGAGATTTCAACAGAACTTGGGTTTAATTTTCCTTAGTGCATATGATGATCTGATGGAGGGAGTGATCTCTTTCCTGATGGTCTAAATCCGCATCAGAATTTCTCCTCATTCTGGAAATCTGTGCATTTCTGATGGATTTCACGGATTCTCCCTCCACCTCCACCACCACTCTTCCACCGCCA...

CDS

Download CDS FASTA

1125 bp · TkA05G464270|TK1151|CDS

ATGGATTTCACGGATTCTCCCTCCACCTCCACCACCACTCTTCCACCGCCAGCGGCGTCCTCCGAAACCTCTCCTCTTCTATCTGGCTCCACTCTCCAAAATGCTTCCTCCCAGGAAGATCATTACGTAGCATCCATAACCGAAGAACATGAAGTAACCTGCTGGGGATGTGGATTATGCCTTATTCTTTCCCCCTACAATCCCGTTTTCAAGTGCGGTTGGTGTGGAGCCATAAACGATCACAATGCAGTAAAAAACGA...

Protein

Download Protein FASTA

374 aa · TkA05G464270|TK1151|PROTEIN

MDFTDSPSTSTTTLPPPAASSETSPLLSGSTLQNASSQEDHYVASITEEHEVTCWGCGLCLILSPYNPVFKCGWCGAINDHNAVKNDKKYLWWRRWRDRCFLCVLLLFMLFIIGGGIWAIYPIIFSESYFFGVFHMTIAVVLSITTFSTFALAAFRSPGTPPLIPWGSYPAVGKGGLEGYTFCNYCSKPKSPNSHHCRSCGMCVLDMDHHCPFIGNCVGAGNHRVFILFLMSSVISNFYVSLISSYAAFRIWPPVTNIPM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G464270`
TK1151 ID	TkA05G464270
OH-1004 ID	LXL04_022391
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G464270

Location Chr05:116304457-116306493 (+)

Description Similar to PAT11: Protein S-acyltransferase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18620`	S-acyltransferase involved in protein lipid modification.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022391 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0006974 DNA damage response Biological Process

GO:0018345 protein palmitoylation Biological Process

GO:0005774 vacuolar membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016409 palmitoyltransferase activity Molecular Function

GO:0019706 protein-cysteine S-palmitoyltransferase activity Molecular Function

KEGG gene cross-reference

afm:AFUA_2G16480

ath:AT3G18620

hsa:84287

mcf:101926118

mmu:74168

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.321

Rank 1 · TkA05G464270 · TK1151

Endoplasmic reticulum0.318

Rank 2 · TkA05G464270 · TK1151

Lysosome / Vacuole0.197

Rank 3 · TkA05G464270 · TK1151

Cytoplasm0.169

Rank 4 · TkA05G464270 · TK1151

Cell membrane0.121

Rank 5 · TkA05G464270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02238COX7a86-125 aa

PF01529DHHC101-147 aa

PF19616DUF6121120-167 aa

PF01529DHHC180-328 aa

PF19616DUF6121217-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G464270	`PF02238`	COX7a	86	125	0.069	14.3
TkA05G464270	`PF01529`	DHHC	101	147	1.9e-29	103.1
TkA05G464270	`PF19616`	DUF6121	120	167	5.3	7.5
TkA05G464270	`PF01529`	DHHC	180	328	1.9e-29	103.1
TkA05G464270	`PF19616`	DUF6121	217	242	5.3	7.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIH7`	Arabidopsis thaliana	sp\|Q9LIH7\|ZDHC7_ARATH Protein S-acyltransferase 11	52.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card