TkA05G463660 | RubberDandelionOmics

Gene overview

TkA05G463660

Reference: TK1151 Chr: Chr05 Coordinates: 116125437-116130327 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3263 bp · TkA05G463660|TK1151|cDNA

CTCCTCCAATGGTTGTTCTTTTTCCTCGGACAGAAAAAATGCTATCTTCAGTGCAAAACCCTCGCATCCTCCTCCTCCACTGCCGGTGGTCTAAACCTCTCCACCACCACCGCCATTATCCCAGAGCCATCCACGCCGTCGCTCAAGCTCAGGCGGTATCGACATCCTCGTCCACCTCTCAAATCCAAATTATCCAAAAATCCATCCATTCGCGGGAGAAAACAGCTCGCCAATTTGCCGAAGAATTTCTCAACCGTCTC...

CDS

Download CDS FASTA

2343 bp · TkA05G463660|TK1151|CDS

ATGGTTGTTCTTTTTCCTCGGACAGAAAAAATGCTATCTTCAGTGCAAAACCCTCGCATCCTCCTCCTCCACTGCCGGTGGTCTAAACCTCTCCACCACCACCGCCATTATCCCAGAGCCATCCACGCCGTCGCTCAAGCTCAGGCGGTATCGACATCCTCGTCCACCTCTCAAATCCAAATTATCCAAAAATCCATCCATTCGCGGGAGAAAACAGCTCGCCAATTTGCCGAAGAATTTCTCAACCGTCTCCGCTTAAC...

Protein

Download Protein FASTA

780 aa · TkA05G463660|TK1151|PROTEIN

MVVLFPRTEKMLSSVQNPRILLLHCRWSKPLHHHRHYPRAIHAVAQAQAVSTSSSTSQIQIIQKSIHSREKTARQFAEEFLNRLRLTEPHVKSFLHVSETVLNEADEIDRKIDRNEDVGPLAGVLVAVKDNICTADMPSTAGSKILENYRPPFDATAVRKLKESGAIIVGKTNLDEFGMGSTTEGSAYQVTANPWDLECVPGGSSGGSAAAVSARQCVVSLGSDTGGSVRQPASFCGVVGLKPTYGRVSRYGLVAYASSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G463660`
TK1151 ID	TkA05G463660
OH-1004 ID	LXL04_022370
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 98.662 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G463660

Location Chr05:116125437-116130327 (+)

Description Similar to GATA: Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25660`	Catalytic subunit of the mitochondrial Glu-tRNA(Gln) amidotransferase complex GatCAB.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q25A68`	Catalytic subunit of the mitochondrial Glu-tRNA(Gln) amidotransferase complex GatCAB.	No verified direct reference in this release
`Os04g0643200`	Catalytic subunit of the mitochondrial Glu-tRNA(Gln) amidotransferase complex GatCAB.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022370 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0032543 mitochondrial translation Biological Process

GO:0070681 glutaminyl-tRNAGln biosynthesis via transamidation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0030956 glutamyl-tRNA(Gln) amidotransferase complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Molecular Function

GO:0050567 glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity Molecular Function

KEGG gene cross-reference

ath:AT3G25660

sbi:8079563

vvi:100247231

zma:100280064

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.617

Rank 1 · TkA05G463660 · TK1151

Mitochondrion0.334

Rank 2 · TkA05G463660 · TK1151

Cytoplasm0.125

Rank 3 · TkA05G463660 · TK1151

Nucleus0.069

Rank 4 · TkA05G463660 · TK1151

Peroxisome0.049

Rank 5 · TkA05G463660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01425Amidase78-520 aa

PF22946SPEF2_D5629-693 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G463660	`PF01425`	Amidase	78	520	7.4e-145	484.1
TkA05G463660	`PF22946`	SPEF2_D5	629	693	0.17	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LI77`	Arabidopsis thaliana	sp\|Q9LI77\|GATA_ARATH Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial	70.200%	Swiss-Prot	High
`Q25A68`	Oryza sativa subsp. indica	sp\|Q25A68\|GATA_ORYSI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial	66.900%	Swiss-Prot	High
`Q7X8Z8`	Oryza sativa subsp. japonica	sp\|Q7X8Z8\|GATA_ORYSJ Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial	67.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card