TkA05G462430 | RubberDandelionOmics

Gene overview

TkA05G462430

Reference: TK1151 Chr: Chr05 Coordinates: 115828723-115830766 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1040 bp · TkA05G462430|TK1151|cDNA

AGACAACCCTCTTTGGCAAATTAAATACAAGCTTTGTATTATAAAAGGATTCATATATGGAGGGTTTCACATCAAACTCCCATACCCTTAAACCTTCATATTCTTTCATAGACATCGACCAAAACATGGATTTGTTTAATCAATTTTCAATCCAATATGACAATATTCCAAACATGAATTCTCAGAGCTTAATGGGATTTTCAAATGACAACATCTTGTATCAACAAGTATTACCACCATTTGACCATCAATTCTTTCAA...

CDS

Download CDS FASTA

828 bp · TkA05G462430|TK1151|CDS

ATGGAGGGTTTCACATCAAACTCCCATACCCTTAAACCTTCATATTCTTTCATAGACATCGACCAAAACATGGATTTGTTTAATCAATTTTCAATCCAATATGACAATATTCCAAACATGAATTCTCAGAGCTTAATGGGATTTTCAAATGACAACATCTTGTATCAACAAGTATTACCACCATTTGACCATCAATTCTTTCAAAGCTTTCAACCAGTTTCTCATCAAAATGATACAAAGAATTTTATGGTGATTCATGA...

Protein

Download Protein FASTA

275 aa · TkA05G462430|TK1151|PROTEIN

MEGFTSNSHTLKPSYSFIDIDQNMDLFNQFSIQYDNIPNMNSQSLMGFSNDNILYQQVLPPFDHQFFQSFQPVSHQNDTKNFMVIHEPIPTGPVISGKRKSTDVSASSSGNSSSQSVHNEINQKKYKSSGKGKKVKATENGEVPKEVVHVRARRGQATDSHSIAERVRRGKINERLRCLQDIVPGCYKSMGMAVMLDEIINYVQSLQNQVDFLSMKLTEASIFHNFDSDSKQMEALQMGNTTDQSVKMQRLEERGEIGPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G462430`
TK1151 ID	TkA05G462430
OH-1004 ID	LXL04_022355
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G462430

Location Chr05:115828723-115830766 (-)

Description Similar to BEE1: Transcription factor BEE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73830`	Positive regulator of brassinosteroid signaling.	No verified direct reference in this release
`At1g18400`	Positive regulator of brassinosteroid signaling.	No verified direct reference in this release
`At1g25330`	Transcription factor bHLH75.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YXI4`	Together with BCL2, positive regulator of cell elongation at least partially through increased gibberellic acid (GA) biosynthesis.	No verified direct reference in this release
`Os08g0536800`	Together with BCL2, positive regulator of cell elongation at least partially through increased gibberellic acid (GA) biosynthesis.	Modulation of Rice Leaf Angle and Grain Size by Expressing OsBCL1 and OsBCL2 under the Control of OsBUL1 Promoter.2021 · DOI: 10.3390/ijms22157792

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022355 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0010372 positive regulation of gibberellin biosynthetic process Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0051510 regulation of unidimensional cell growth Biological Process

GO:0071368 cellular response to cytokinin stimulus Biological Process

GO:1902448 positive regulation of shade avoidance Biological Process

GO:2000488 positive regulation of brassinosteroid biosynthetic process Biological Process

GO:2000762 regulation of phenylpropanoid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G18400

ath:AT1G25330

ath:AT1G73830

ath:AT5G50915

dosa:Os08g0536800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.978

Rank 1 · TkA05G462430 · TK1151

Cytoplasm0.104

Rank 2 · TkA05G462430 · TK1151

Cell membrane0.022

Rank 3 · TkA05G462430 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA05G462430 · TK1151

Plastid0.010

Rank 5 · TkA05G462430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26154DUF804220-53 aa

PF15027MGT5A_N105-129 aa

PF23177bHLH_IRO3159-214 aa

PF00010HLH160-207 aa

PF26154DUF8042161-221 aa

PF23173bHLH_SAC51165-209 aa

PF23174bHLH_ILI179-219 aa

PF15027MGT5A_N192-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G462430	`PF26154`	DUF8042	20	53	0.17	13.0
TkA05G462430	`PF15027`	MGT5A_N	105	129	0.19	12.2
TkA05G462430	`PF23177`	bHLH_IRO3	159	214	0.024	15.7
TkA05G462430	`PF00010`	HLH	160	207	3.6e-05	24.2
TkA05G462430	`PF26154`	DUF8042	161	221	0.17	13.0
TkA05G462430	`PF23173`	bHLH_SAC51	165	209	2.8e-06	27.9
TkA05G462430	`PF23174`	bHLH_ILI	179	219	0.058	14.5
TkA05G462430	`PF15027`	MGT5A_N	192	221	0.19	12.2
TkA05G462430	`PF16487`	ArgoMid	194	235	0.2	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWK7`	Arabidopsis thaliana	sp\|Q8GWK7\|BEE3_ARATH Transcription factor BEE 3	53.400%	Swiss-Prot	Medium
`Q8GZ13`	Arabidopsis thaliana	sp\|Q8GZ13\|BEE1_ARATH Transcription factor BEE 1	70.300%	Swiss-Prot	Low
`A4D998`	Arabidopsis thaliana	sp\|A4D998\|BH075_ARATH Transcription factor bHLH75	56.600%	Swiss-Prot	Low
`A2YXI4`	Oryza sativa subsp. indica	sp\|A2YXI4\|BCL1_ORYSI Basic helix-loop-helix protein 80	45.900%	Swiss-Prot	Medium
`A3BV95`	Oryza sativa subsp. japonica	sp\|A3BV95\|BCL1_ORYSJ Basic helix-loop-helix protein 80	45.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card