RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G461990
Reference: TK1151 Chr: Chr05 Coordinates: 115726823-115730440 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2478 bp · TkA05G461990|TK1151|cDNA

ACGGGTATCCTAGATTGGAGGAGTATGTTTTCCATAAATACCCCTTCCTCTCTATCCGGTGCAAGTTCCAACAACATCAATGACGAGAAACACTATCAAGTGACGCCGAACGACACAAAAACACTTCCATTTTATGGTCTGATCGACGCCGGATGCAACAGTAGAAGATGGGAAGATCCACCACATCTTGCTTCAAGATCATTTCTTGTGGGGGTAGTGATGAATCTGTTGATAGAGATGATATTGATGCTCCTTCCGAG...

CDS

Download CDS FASTA

1611 bp · TkA05G461990|TK1151|CDS

ATGCAAGGTCTTGTCCGTGCTCGTCGTGCTGACGTGGCACATCCGACTTATATTTCCATTGAGAAGTTGCTGAGTAACAGTCTTGCTCGCCAGCTACTGGAATCTGCACCAAAGACGAAACAAATCAACATCAAATGTGTTCCTTCAAAATCTGATTCCGCTTGGAATTGGTTGGAGAGATGGATGTCTGCATCTACACCAGAAACAGTGGAATCACATGCACCGGAACAGAATCAAGATCAAAGTCAAGAAAAGCTTAA...

Protein

Download Protein FASTA

536 aa · TkA05G461990|TK1151|PROTEIN

MQGLVRARRADVAHPTYISIEKLLSNSLARQLLESAPKTKQINIKCVPSKSDSAWNWLERWMSASTPETVESHAPEQNQDQSQEKLNNTENEVQTVVPDCEPVELESDADEKENSVNHTGNEVQTVIPDCESMELESNAEEKSNHEEEEDPQPINTHTNTQKAENVLEEPVVEKTISETEPKRVTKRLATDEADSERRKSVFGSRKASNPAFIAAQSRFEELTSKTTNKSKPSKQENDDNTPEDITTAPIDNTPADTTTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G461990
TK1151 IDTkA05G461990
OH-1004 IDLXL04_022352
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)98.000
Protein coverage (%)TK1151 100.000 / OH-1004 74.548
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G461990
LocationChr05:115726823-115730440 (-)
DescriptionSimilar to IQD32: Protein IQ-DOMAIN 32
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g19870 May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity). No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022352 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000325 plant-type vacuole Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005635 nuclear envelope Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005856 cytoskeleton Cellular Component
GO:0005875 microtubule associated complex Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009941 chloroplast envelope Cellular Component
GO:0005516 calmodulin binding Molecular Function
KEGG gene cross-reference
ath:AT1G14380
ath:AT1G18840
ath:AT1G19870
ath:AT1G74690
ath:AT2G02790
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.545
Rank 1 · TkA05G461990 · TK1151
Nucleus0.299
Rank 2 · TkA05G461990 · TK1151
Cell membrane0.272
Rank 3 · TkA05G461990 · TK1151
Endoplasmic reticulum0.045
Rank 4 · TkA05G461990 · TK1151
Golgi apparatus0.037
Rank 5 · TkA05G461990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13178DUF400565-69 aa
PF13178DUF4005210-214 aa
PF13178DUF4005377-415 aa
PF13178DUF4005442-513 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G461990PF13178DUF400565697.1e-0627.3
TkA05G461990PF13178DUF40052102147.1e-0627.3
TkA05G461990PF13178DUF40053774157.1e-0627.3
TkA05G461990PF13178DUF40054425137.1e-0627.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FXI5Arabidopsis thalianasp|Q9FXI5|IQD32_ARATH Protein IQ-DOMAIN 3228.500%Swiss-ProtLow

JBrowse

View in Genome Browser