TkA05G461980 | RubberDandelionOmics

Gene overview

TkA05G461980

Reference: TK1151 Chr: Chr05 Coordinates: 115721159-115724253 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1717 bp · TkA05G461980|TK1151|cDNA

TCTTAATCGAAATCTGACTCTTCATCTCAAATACCTTTCCTTGTATTCATAGGGGGCTAAAAAGCGTATATATCCCTCTCTCTCTCTCTCTGGCTTGACCTATCATACGCCCATCGTCACCGTCTTCCACCCATCATAACCTGTCGCCAACCTAATCAATCCACCACAAAATCCCTAAATCAAAACCGCCGTGCTTTTAGGCTCACGCGATTACGTTAAAACGGTCGCTAACAAGTTAGTCAATTAAGGGTTTTAGAAGA...

CDS

Download CDS FASTA

1077 bp · TkA05G461980|TK1151|CDS

ATGCGCGGATTGCAGAAATCAAAAAAGGTTTCATGGCCTTCAGATTTAAATCTTTGTCAGGTGAAGCTGTTTTTATCAGATGAATCTCCTTCTCAAGTGGGATTGGGCGGTCAAGATCATCTCCAAGCAAAGGAATCTTGGCATTCAGATGACAACTTGCCACCTGGCTTTGAAGGAATTCAGCCTGCAAACTTATTTCAGAATAAATTGTCTCAAATTACTCTCATTCAATGGAAATGTCCTTCTAGATTTGTTGTGGA...

Protein

Download Protein FASTA

358 aa · TkA05G461980|TK1151|PROTEIN

MRGLQKSKKVSWPSDLNLCQVKLFLSDESPSQVGLGGQDHLQAKESWHSDDNLPPGFEGIQPANLFQNKLSQITLIQWKCPSRFVVDPNWQVTAGEESKEVDLESQREMRVLEAVYPRPSAIPPNPASPIQDESYNDHLTPLIPVTPIEDDDTSSVPTTNGMPPPGIEPDVMNAAYTALTTAMSSSQGNLIDPNLLIKILSTPTLIEKLVSTHGPPSAAMLPPVTAAHVPSSTPSSSTAPHYARLGGPVHVHVPLPPPPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G461980`
TK1151 ID	TkA05G461980
OH-1004 ID	LXL04_022351
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G461980

Location Chr05:115721159-115724253 (+)

Description Similar to At1g19860: Zinc finger CCCH domain-containing protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19860`	Zinc finger CCCH domain-containing protein 6.	No verified direct reference in this release
`At5g66270`	Zinc finger CCCH domain-containing protein 68.	No verified direct reference in this release
`At4g02560`	Seems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0663200`	Zinc finger CCCH domain-containing protein 30.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022351 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G19860

ath:AT3G51180

ath:AT5G66270

dosa:Os04g0663200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.924

Rank 1 · TkA05G461980 · TK1151

Cytoplasm0.192

Rank 2 · TkA05G461980 · TK1151

Cell membrane0.022

Rank 3 · TkA05G461980 · TK1151

Mitochondrion0.016

Rank 4 · TkA05G461980 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA05G461980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00642zf-CCCH308-330 aa

PF18044zf-CCCH_4308-330 aa

PF14608zf-CCCH_2309-329 aa

PF18345zf_CCCH_4310-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G461980	`PF00642`	zf-CCCH	308	330	0.098	13.3
TkA05G461980	`PF18044`	zf-CCCH_4	308	330	0.12	12.9
TkA05G461980	`PF14608`	zf-CCCH_2	309	329	0.26	12.6
TkA05G461980	`PF18345`	zf_CCCH_4	310	329	0.6	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56XU4`	Arabidopsis thaliana	sp\|Q56XU4\|C3H6_ARATH Zinc finger CCCH domain-containing protein 6	43.400%	Swiss-Prot	Medium
`Q9FH61`	Arabidopsis thaliana	sp\|Q9FH61\|C3H68_ARATH Zinc finger CCCH domain-containing protein 68	38.000%	Swiss-Prot	Medium
`Q38796`	Arabidopsis thaliana	sp\|Q38796\|LUMI_ARATH Homeobox protein LUMINIDEPENDENS	35.000%	Swiss-Prot	Low
`Q7XM16`	Oryza sativa subsp. japonica	sp\|Q7XM16\|C3H30_ORYSJ Zinc finger CCCH domain-containing protein 30	34.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card