TkA05G456570 | RubberDandelionOmics

Gene overview

TkA05G456570

Reference: TK1151 Chr: Chr05 Coordinates: 114379683-114381464 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

891 bp · TkA05G456570|TK1151|cDNA

ATGACGGTGATATTAACGGTGAGATTCTCGGGTCCAATATTCTGTATTATGTCTAGGTCCGATATCTGGGATTCCATTAAGATCCCACTGATATTAACCGTGGGAGATGATGAGGAGCAGAAAAATTCATCCGTATCATCATCATCATCATCAGGTCAACGACTGCGACCCAAAGAACACGAAGGTAAGAGGAAGGATTCATCCACATCAGTGTCAATAGATAAACAGTGTCGACCTTTTTCACTTGCTGAAATCAAGTT...

CDS

Download CDS FASTA

891 bp · TkA05G456570|TK1151|CDS

ATGACGGTGATATTAACGGTGAGATTCTCGGGTCCAATATTCTGTATTATGTCTAGGTCCGATATCTGGGATTCCATTAAGATCCCACTGATATTAACCGTGGGAGATGATGAGGAGCAGAAAAATTCATCCGTATCATCATCATCATCATCAGGTCAACGACTGCGACCCAAAGAACACGAAGGTAAGAGGAAGGATTCATCCACATCAGTGTCAATAGATAAACAGTGTCGACCTTTTTCACTTGCTGAAATCAAGTT...

Protein

Download Protein FASTA

296 aa · TkA05G456570|TK1151|PROTEIN

MTVILTVRFSGPIFCIMSRSDIWDSIKIPLILTVGDDEEQKNSSVSSSSSSGQRLRPKEHEGKRKDSSTSVSIDKQCRPFSLAEIKLATHDFDDALVIGKGGFGNVYKGNVDFGKGTDVAIKRLKLDSDQGATEFRAEIEMLSKFRHSHIVSLLGYHEASDNREMILVYEYMPNGSLEDHLHKRRTKGTNSHLLTWVQRLHICVGAARGLDYLHTGTGVQSRVIHRDIKSSNILLDENLAGKISDFGLSRIGPANQSGTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G456570`
TK1151 ID	TkA05G456570
OH-1004 ID	LXL04_022237
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.649 / OH-1004 17.360 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G456570

Location Chr05:114379683-114381464 (+)

Description Similar to PIX13: Probable serine/threonine-protein kinase PIX13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At2g21480`	Probable receptor-like protein kinase At2g21480.	No verified direct reference in this release
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022237 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004713 protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G07570

ath:AT2G17220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.627

Rank 1 · TkA05G456570 · TK1151

Cytoplasm0.266

Rank 2 · TkA05G456570 · TK1151

Nucleus0.222

Rank 3 · TkA05G456570 · TK1151

Endoplasmic reticulum0.050

Rank 4 · TkA05G456570 · TK1151

Golgi apparatus0.038

Rank 5 · TkA05G456570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03129HGTP_anticodon22-43 aa

PF12330Haspin_kinase88-161 aa

PF07714PK_Tyr_Ser-Thr97-292 aa

PF00069Pkinase97-293 aa

PF03109ABC198-125 aa

PF01636APH125-197 aa

PF03109ABC1165-250 aa

PF01636APH220-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G456570	`PF03129`	HGTP_anticodon	22	43	0.15	12.9
TkA05G456570	`PF12330`	Haspin_kinase	88	161	0.017	14.9
TkA05G456570	`PF07714`	PK_Tyr_Ser-Thr	97	292	3e-38	132.3
TkA05G456570	`PF00069`	Pkinase	97	293	7.6e-35	121.3
TkA05G456570	`PF03109`	ABC1	98	125	0.026	14.4
TkA05G456570	`PF01636`	APH	125	197	0.0031	18.0
TkA05G456570	`PF03109`	ABC1	165	250	0.026	14.4
TkA05G456570	`PF01636`	APH	220	254	0.0031	18.0
TkA05G456570	`PF12330`	Haspin_kinase	225	266	0.017	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	58.800%	Swiss-Prot	High
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	58.000%	Swiss-Prot	High
`Q9SCZ4`	Arabidopsis thaliana	sp\|Q9SCZ4\|FERON_ARATH Receptor-like protein kinase FERONIA	56.000%	Swiss-Prot	High
`Q9SJT0`	Arabidopsis thaliana	sp\|Q9SJT0\|Y2214_ARATH Probable receptor-like protein kinase At2g21480	55.800%	Swiss-Prot	High
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	53.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card