TkA05G456360 | RubberDandelionOmics

Gene overview

TkA05G456360

Reference: TK1151 Chr: Chr05 Coordinates: 114301320-114303479 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1116 bp · TkA05G456360|TK1151|cDNA

ATGCTGTCTTCAGTCTTCAGGGTGTCTTCAGATCAGGGCGCTGATAAGGTCTTCAGTCTTCAGGGCGCTGATGCTGTCTTCAGTCTTCAGACGCTGATGCTGATGAAGTCTTCAGATCCAGATCTAATCAGCTCGTGTTGCCTAGATCTGGTCTTCAGTCTTCGGTCTTCAGAACTTGAGTATCTTCAGAATATCTTCACACTATGTAATCTGACAATCAGAATGTTTCCTCCATATCCTGATTTGGGGGTGCGACATGT...

CDS

Download CDS FASTA

1116 bp · TkA05G456360|TK1151|CDS

ATGCTGTCTTCAGTCTTCAGGGTGTCTTCAGATCAGGGCGCTGATAAGGTCTTCAGTCTTCAGGGCGCTGATGCTGTCTTCAGTCTTCAGACGCTGATGCTGATGAAGTCTTCAGATCCAGATCTAATCAGCTCGTGTTGCCTAGATCTGGTCTTCAGTCTTCGGTCTTCAGAACTTGAGTATCTTCAGAATATCTTCACACTATGTAATCTGACAATCAGAATGTTTCCTCCATATCCTGATTTGGGGGTGCGACATGT...

Protein

Download Protein FASTA

371 aa · TkA05G456360|TK1151|PROTEIN

MLSSVFRVSSDQGADKVFSLQGADAVFSLQTLMLMKSSDPDLISSCCLDLVFSLRSSELEYLQNIFTLCNLTIRMFPPYPDLGVRHVSSMVANTVSNTAVSVTATTVSNTAVSVTTTTVSNTATTISNTVTTISNIITTISNIITTISNTITIYGYTRVHTRGGGDSRREEVLARAWCGHSGDARYGNDQNAKQFWKHVTKRFNRELGKGPKYRTFDQCNSKWNKMNREVQKFNGAYVNYRNQPHSGENDTDILARAEAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G456360`
TK1151 ID	TkA05G456360
OH-1004 ID	LXL04_019886
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.300
Protein coverage (%)	TK1151 53.639 / OH-1004 48.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G456360`
Location	Chr05:114301320-114303479 (+)
Description	Similar to GSTT3: Glutathione S-transferase T3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019886` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009407 toxin catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005777 peroxisome Cellular Component GO:0009536 plastid Cellular Component GO:0004364 glutathione transferase activity Molecular Function
KEGG gene cross-reference	ath:AT5G41220 ath:AT5G41240 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.710

Rank 1 · TkA05G456360 · TK1151

Cytoplasm0.304

Rank 2 · TkA05G456360 · TK1151

Cell membrane0.043

Rank 3 · TkA05G456360 · TK1151

Extracellular0.039

Rank 4 · TkA05G456360 · TK1151

Endoplasmic reticulum0.034

Rank 5 · TkA05G456360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25728US2993-150 aa

PF26772GVIN1_C109-122 aa

PF04513Baculo_PEP_C113-150 aa

PF13837Myb_DNA-bind_4171-234 aa

PF26772GVIN1_C188-229 aa

PF13873Myb_DNA-bind_5193-231 aa

PF29639D1044-6_helical212-244 aa

PF29639D1044-6_helical300-370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G456360	`PF25728`	US29	93	150	1.8	8.2
TkA05G456360	`PF26772`	GVIN1_C	109	122	0.16	13.0
TkA05G456360	`PF04513`	Baculo_PEP_C	113	150	0.26	12.1
TkA05G456360	`PF13837`	Myb_DNA-bind_4	171	234	0.00014	22.9
TkA05G456360	`PF26772`	GVIN1_C	188	229	0.16	13.0
TkA05G456360	`PF13873`	Myb_DNA-bind_5	193	231	0.015	15.9
TkA05G456360	`PF29639`	D1044-6_helical	212	244	0.65	11.4
TkA05G456360	`PF29639`	D1044-6_helical	300	370	0.65	11.4
TkA05G456360	`PF13873`	Myb_DNA-bind_5	314	334	0.015	15.9
TkA05G456360	`PF04513`	Baculo_PEP_C	319	337	0.26	12.1
TkA05G456360	`PF13837`	Myb_DNA-bind_4	320	336	0.00014	22.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card