TkA05G454180 | RubberDandelionOmics

Gene overview

TkA05G454180

Reference: TK1151 Chr: Chr05 Coordinates: 113698387-113702404 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1555 bp · TkA05G454180|TK1151|cDNA

TTTACATTTACTCACCATTATCCAAATAGTCTTGAAGAATATTACTAAACGCTCCCAACTACTATAAATAGCAATATCAGCCCGCAAAGCTCTAACGTATTATTGTCAGCAATAATACAGACTCAAAACCCACTTCCGATCATTAATCATGGACGGAAAAAGCTCCAGCAACACCGCCGGCAAGCCAATCCGATGCAGAGCTGCGATTGCTAGGAAAGCAGGGGAGCCGCTGGTGATAGAAGACGTGATAGTCGCCCCAC...

CDS

Download CDS FASTA

1161 bp · TkA05G454180|TK1151|CDS

ATGGACGGAAAAAGCTCCAGCAACACCGCCGGCAAGCCAATCCGATGCAGAGCTGCGATTGCTAGGAAAGCAGGGGAGCCGCTGGTGATAGAAGACGTGATAGTCGCCCCACCAAATCCTCATGAAGTCAGAATCAAAATCACATGTACTTCTCTTTGTCACAGTGACGTCACCATTTGGAAACTCAAGGATCCTCCTGCTATCTTTCCAAGAATACTTGGCCATGAAGCCGTGGGGGTGATTGAGAGTGTGGGAAAAGG...

Protein

Download Protein FASTA

386 aa · TkA05G454180|TK1151|PROTEIN

MDGKSSSNTAGKPIRCRAAIARKAGEPLVIEDVIVAPPNPHEVRIKITCTSLCHSDVTIWKLKDPPAIFPRILGHEAVGVIESVGKGVDEFVEGDTVIPTFVSDCGECRDCKSEKSNLCTKFPFGISPWMRDETSRFTDINGETLYHFVYVSSFSEYTVVDIAHVTKIDPIIPPNKACLLGCGVSTGVGAAWRTAKVEAGSTVAIFGLGSIGLAVAEGARLCGAKRIIGVDVNQDKCEIGKKFGVTDFINSRNIGDKTVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G454180`
TK1151 ID	TkA05G454180
OH-1004 ID	LXL04_022266
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G454180

Location Chr05:113698387-113702404 (-)

Description Similar to At5g42250: Alcohol dehydrogenase-like 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42250`	Alcohol dehydrogenase-like 7.	No verified direct reference in this release
`At4g22110`	Alcohol dehydrogenase-like 5.	No verified direct reference in this release
`At1g22430`	Alcohol dehydrogenase-like 1.	No verified direct reference in this release
`At1g22440`	Alcohol dehydrogenase-like 2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XAZ3`	Alcohol dehydrogenase class-3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022266 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046294 formaldehyde catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004022 alcohol dehydrogenase (NAD+) activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0051903 S-(hydroxymethyl)glutathione dehydrogenase [NAD(P)+] activity Molecular Function

GO:0106321 S-(hydroxymethyl)glutathione dehydrogenase (NADP+) activity Molecular Function

GO:0106322 S-(hydroxymethyl)glutathione dehydrogenase (NAD+) activity Molecular Function

KEGG gene cross-reference

ath:AT1G22430

ath:AT1G22440

ath:AT4G22110

ath:AT5G42250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.582

Rank 1 · TkA05G454180 · TK1151

Nucleus0.189

Rank 2 · TkA05G454180 · TK1151

Cell membrane0.097

Rank 3 · TkA05G454180 · TK1151

Peroxisome0.087

Rank 4 · TkA05G454180 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA05G454180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08240ADH_N40-168 aa

PF028262-Hacid_dh_C199-238 aa

PF16912Glu_dehyd_C201-370 aa

PF02254TrkA_N203-250 aa

PF00107ADH_zinc_N211-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G454180	`PF08240`	ADH_N	40	168	9.9e-23	81.1
TkA05G454180	`PF02826`	2-Hacid_dh_C	199	238	0.0015	18.6
TkA05G454180	`PF16912`	Glu_dehyd_C	201	370	0.00053	20.2
TkA05G454180	`PF02254`	TrkA_N	203	250	0.034	15.2
TkA05G454180	`PF00107`	ADH_zinc_N	211	331	1.2e-23	84.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FH04`	Arabidopsis thaliana	sp\|Q9FH04\|ADHL7_ARATH Alcohol dehydrogenase-like 7	68.700%	Swiss-Prot	High
`Q0V7W6`	Arabidopsis thaliana	sp\|Q0V7W6\|ADHL5_ARATH Alcohol dehydrogenase-like 5	61.200%	Swiss-Prot	High
`Q9SK86`	Arabidopsis thaliana	sp\|Q9SK86\|ADHL1_ARATH Alcohol dehydrogenase-like 1	59.100%	Swiss-Prot	High
`Q9SK87`	Arabidopsis thaliana	sp\|Q9SK87\|ADHL2_ARATH Alcohol dehydrogenase-like 2	59.800%	Swiss-Prot	High
`A2XAZ3`	Oryza sativa subsp. indica	sp\|A2XAZ3\|ADHX_ORYSI Alcohol dehydrogenase class-3	50.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card