TkA05G454120 | RubberDandelionOmics

Gene overview

TkA05G454120

Reference: TK1151 Chr: Chr05 Coordinates: 113683593-113684193 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA05G454120|TK1151|cDNA

ATGGACCAATCTGAGCGTTACTCCTACAACCCGACGCTGCGCTGGAATCCTCAAGTGGAAGAGTATTTCAGCAAAGCGTATGGAGCTGAAGCTTTTTCTCGCATTTGCAAAGCTCTAACACGGCCTTCTTGTTACTCTTGTATACGTGTAAATACACAGAGAACAACAACTGAAGCTGTCATTGAGAAGATTTTGGAGATTCAACGTGAGAAGAGGCTTCATGACACTGTAAACAATCAGCATATGAACAATGATGCAAA...

CDS

Download CDS FASTA

411 bp · TkA05G454120|TK1151|CDS

ATGGACCAATCTGAGCGTTACTCCTACAACCCGACGCTGCGCTGGAATCCTCAAGTGGAAGAGTATTTCAGCAAAGCGTATGGAGCTGAAGCTTTTTCTCGCATTTGCAAAGCTCTAACACGGCCTTCTTGTTACTCTTGTATACGTGTAAATACACAGAGAACAACAACTGAAGCTGTCATTGAGAAGATTTTGGAGATTCAACGTGAGAAGAGGCTTCATGACACTGTAAACAATCAGCATATGAACAATGATGCAAA...

Protein

Download Protein FASTA

136 aa · TkA05G454120|TK1151|PROTEIN

MDQSERYSYNPTLRWNPQVEEYFSKAYGAEAFSRICKALTRPSCYSCIRVNTQRTTTEAVIEKILEIQREKRLHDTVNNQHMNNDAKVETLSVDSSRSETSPVLKCQIPGLDYVVFVKGSGPHDIQYDYQQDTPPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G454120`
TK1151 ID	TkA05G454120
OH-1004 ID	LXL04_022263
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 85.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G454120

Location Chr05:113683593-113684193 (-)

Description Similar to NOP2C: rRNA (cytosine-C(5))-methyltransferase NOP2C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06560`	Involved in ribosomal large subunit assembly (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022263 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001510 RNA methylation Biological Process

GO:0006364 rRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0008173 RNA methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.629

Rank 1 · TkA05G454120 · TK1151

Cytoplasm0.356

Rank 2 · TkA05G454120 · TK1151

Mitochondrion0.072

Rank 3 · TkA05G454120 · TK1151

Cell membrane0.050

Rank 4 · TkA05G454120 · TK1151

Endoplasmic reticulum0.031

Rank 5 · TkA05G454120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00967Barwin15-66 aa

PF22458RsmF-B_ferredox23-65 aa

PF18106Rol_Rep_N48-100 aa

PF22458RsmF-B_ferredox77-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G454120	`PF00967`	Barwin	15	66	0.025	15.2
TkA05G454120	`PF22458`	RsmF-B_ferredox	23	65	4.2e-05	24.3
TkA05G454120	`PF18106`	Rol_Rep_N	48	100	0.17	12.8
TkA05G454120	`PF22458`	RsmF-B_ferredox	77	102	4.2e-05	24.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84MA1`	Arabidopsis thaliana	sp\|Q84MA1\|NOP2C_ARATH rRNA (cytosine-C(5))-methyltransferase NOP2C	57.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card