TkA05G453610 | RubberDandelionOmics

Gene overview

TkA05G453610

Reference: TK1151 Chr: Chr05 Coordinates: 113549792-113554323 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2031 bp · TkA05G453610|TK1151|cDNA

GAAAGCTTTTGTCAAAATGTGTTTGAATCATTTTCTCCTGTAAATACGATTCGAATCTCAGATCTTTCCGAATCCTCAATTGCGTGGTAAAATTTCACTCATATGGCGTATGTTAGCAACATGGCGGAGATCGACGGAAGAAGCGGTTACTGTAAGTCAAACTCAACCTTTTACAGCAAACGGAAACCGGCACCATTACCGGCCAATGAAACATTAGATGTAACTACCTTCATCTCAGCACGTGCGCACCACGGCACTGT...

CDS

Download CDS FASTA

1644 bp · TkA05G453610|TK1151|CDS

ATGGCGTATGTTAGCAACATGGCGGAGATCGACGGAAGAAGCGGTTACTGTAAGTCAAACTCAACCTTTTACAGCAAACGGAAACCGGCACCATTACCGGCCAATGAAACATTAGATGTAACTACCTTCATCTCAGCACGTGCGCACCACGGCACTGTCGCTTACATCGACGCATCAACTGGTCACCGCCTTACATTTTCCGATGTATGGAGGGCAGTGGAGTCTGTCTCGTCGTCACTCGCCGACTTCGGCATCCGGAA...

Protein

Download Protein FASTA

547 aa · TkA05G453610|TK1151|PROTEIN

MAYVSNMAEIDGRSGYCKSNSTFYSKRKPAPLPANETLDVTTFISARAHHGTVAYIDASTGHRLTFSDVWRAVESVSSSLADFGIRKGDVVLLLSPNSIFFPIVCLSVMSLGAIITTTNPLNTNREINKQIANSKPVLAFTISDLLPKLADSNLPIVLIGSGTGKGKIVSTLEEMMSKEPNQNRVKERVTQDDTATLLYSSGTTGESKGVISSHRNLIAMVQTVLGRFQLDENQQTFLCTVPMFHIYGLVAFATGLIASG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G453610`
TK1151 ID	TkA05G453610
OH-1004 ID	LXL04_022254
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G453610

Location Chr05:113549792-113554323 (+)

Description Similar to 4CLL5: 4-coumarate--CoA ligase-like 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20510`	Contributes to jasmonic acid biosynthesis by initiating the beta-oxidative chain shortening of its precursors.	Identification of a peroxisomal acyl-activating enzyme involved in the biosynthesis of jasmonic acid in Arabidopsis.2006 · DOI: 10.1074/jbc.m607854200 Jasmonates meet fatty acids: functional analysis of a new acyl-coenzyme A synthetase family from Arabidopsis thaliana.2008 · DOI: 10.1093/jxb/erm325
`At1g20500`	Contributes to jasmonic acid biosynthesis by initiating the beta-oxidative chain shortening of its precursors.	No verified direct reference in this release
`At1g20490`	Carboxylate--CoA ligase that may use 4-coumarate as substrate.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0132000`	Carboxylate--CoA ligase that may use 4-coumarate as substrate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022254 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009698 phenylpropanoid metabolic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016207 4-coumarate-CoA ligase activity Molecular Function

GO:0016405 CoA-ligase activity Molecular Function

GO:0102391 decanoate-CoA ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G20490

ath:AT1G20500

ath:AT1G20510

dosa:Os03g0132000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.603

Rank 1 · TkA05G453610 · TK1151

Cytoplasm0.176

Rank 2 · TkA05G453610 · TK1151

Mitochondrion0.118

Rank 3 · TkA05G453610 · TK1151

Endoplasmic reticulum0.084

Rank 4 · TkA05G453610 · TK1151

Nucleus0.060

Rank 5 · TkA05G453610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501AMP-binding45-407 aa

PF13193AMP-binding_C458-533 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G453610	`PF00501`	AMP-binding	45	407	2.5e-87	293.9
TkA05G453610	`PF13193`	AMP-binding_C	458	533	1.8e-19	71.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84P21`	Arabidopsis thaliana	sp\|Q84P21\|4CLL5_ARATH Peroxisomal OPC-8:0-CoA ligase 1	75.500%	Swiss-Prot	High
`P0C5B6`	Arabidopsis thaliana	sp\|P0C5B6\|4CLL4_ARATH OPC-6:CoA ligase	64.000%	Swiss-Prot	High
`Q3E6Y4`	Arabidopsis thaliana	sp\|Q3E6Y4\|4CLL3_ARATH 4-coumarate--CoA ligase-like 3	62.900%	Swiss-Prot	High
`Q10S72`	Oryza sativa subsp. japonica	sp\|Q10S72\|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4	64.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card