TkA05G451990 | RubberDandelionOmics

Gene overview

TkA05G451990

Reference: TK1151 Chr: Chr05 Coordinates: 113127478-113129227 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

896 bp · TkA05G451990|TK1151|cDNA

GGTCAGTTACAGTGTTACATACGAGTTACGAAGCACAATCACCATACCAGACCACCAAGGAAGGTCTCATTAGTTGTATCTGTGATCGATTAAGCCTCTCTCTCAGCCTCTTCCAACTCTCTGCACTAACAGGCTCATTTTTCCTCTTCCTATCAACTCAAGTGTAAGAAGAGAATTACAAGCAGCTCAAAAATGGCAGCAAGTTCTTTTTCCAAATGCTTTCGTGTGGGTCATTCTTTGCTGTCTTCAAGTACCCAAAT...

CDS

Download CDS FASTA

462 bp · TkA05G451990|TK1151|CDS

ATGGCAGCAAGTTCTTTTTCCAAATGCTTTCGTGTGGGTCATTCTTTGCTGTCTTCAAGTACCCAAATATTATCAAAAGAAACCACCTTCAACAACAATCTCTTGCTTCAGCAAATAAGGACATTCATACAGATGAGGACAAACCTGAAAGTGGTAGACAACTCAGGGGCAAAACGGGTAATGTGCATACAAGCACTGAAGGGGAAGAAGGGGGCAAGATTAGGTGACACGATAGTTGCATCAGTGAAAGAGGCACAGCC...

Protein

Download Protein FASTA

153 aa · TkA05G451990|TK1151|PROTEIN

MAASSFSKCFRVGHSLLSSSTQILSKETTFNNNLLLQQIRTFIQMRTNLKVVDNSGAKRVMCIQALKGKKGARLGDTIVASVKEAQPGGKVKKGQVVYGVVVRAAMQKGRCDGSEVKFDDNAVVLVNKQGEPIGTRVFGPVPHELRKKNMLRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G451990`
TK1151 ID	TkA05G451990
OH-1004 ID	LXL04_011253
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.700
Protein coverage (%)	TK1151 99.346 / OH-1004 45.921 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G451990

Location Chr05:113127478-113129227 (-)

Description Similar to HLP: 50S ribosomal protein HLP, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46160`	Binds to 23S rRNA in mitochondrion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011253 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0048481 plant ovule development Biological Process

GO:0080060 integument development Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005762 mitochondrial large ribosomal subunit Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0003735 structural constituent of ribosome Molecular Function

GO:0070180 large ribosomal subunit rRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G17560

ath:AT5G46160

rbe:RBE_1052

rpr:RP649

rty:RT0641

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.884

Rank 1 · TkA05G451990 · TK1151

Plastid0.054

Rank 2 · TkA05G451990 · TK1151

Nucleus0.021

Rank 3 · TkA05G451990 · TK1151

Cytoplasm0.021

Rank 4 · TkA05G451990 · TK1151

Extracellular0.010

Rank 5 · TkA05G451990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00238Ribosomal_L1443-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G451990	`PF00238`	Ribosomal_L14	43	151	8.4e-43	145.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z17`	Arabidopsis thaliana	sp\|Q93Z17\|HLP_ARATH Large ribosomal subunit protein uL14mz	67.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card