TkA05G451970 | RubberDandelionOmics

Gene overview

TkA05G451970

Reference: TK1151 Chr: Chr05 Coordinates: 113122342-113123719 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1170 bp · TkA05G451970|TK1151|cDNA

ATGGAGGGTGCTGTTCGTTGTTCTGCAAATTACGTTCCTCTTTCACCAATAAGTTTTCTGGAACGAGCAGCTCGTGTTTATGGAGATAGAGTTTCCATTGTTTATGGGGATTACGTGAAGTTCACTTGGAAAGAGACTTATGAACGATGTGTTAAGCTTGCTTCTGCTTTAGTGACACACTTGGGAATATCTCACGGTGACATTGTGGCTGCATTGGCACCAAATGTTCCTGAGTTATACGAGTTACATTTTGGAGTTCC...

CDS

Download CDS FASTA

1170 bp · TkA05G451970|TK1151|CDS

ATGGAGGGTGCTGTTCGTTGTTCTGCAAATTACGTTCCTCTTTCACCAATAAGTTTTCTGGAACGAGCAGCTCGTGTTTATGGAGATAGAGTTTCCATTGTTTATGGGGATTACGTGAAGTTCACTTGGAAAGAGACTTATGAACGATGTGTTAAGCTTGCTTCTGCTTTAGTGACACACTTGGGAATATCTCACGGTGACATTGTGGCTGCATTGGCACCAAATGTTCCTGAGTTATACGAGTTACATTTTGGAGTTCC...

Protein

Download Protein FASTA

389 aa · TkA05G451970|TK1151|PROTEIN

MEGAVRCSANYVPLSPISFLERAARVYGDRVSIVYGDYVKFTWKETYERCVKLASALVTHLGISHGDIVAALAPNVPELYELHFGVPMAGGVLCNLNTRYDSKMVAILLEFSNAKVIFVDYEFLDVANEAVEILGEKSSYVPKIILIPESDKHLSMTKIPVTCDHNILEHKDLLALGSLGFEIKGPNDECDAIALSFTSGTTGNAKGVVYSHRGAYLNSLVVALIMEMPPMPVFLWSVPMFHCNGWNIFGSISQHRVTHM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G451970`
TK1151 ID	TkA05G451970
OH-1004 ID	LXL04_022227
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.000
Protein coverage (%)	TK1151 97.943 / OH-1004 72.482 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G451970

Location Chr05:113122342-113123719 (+)

Description Similar to AAE1: Probable acyl-activating enzyme 1, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20560`	Catalyzes the ligation of CoA on butanoate to produce butanoyl-CoA.	No verified direct reference in this release
`At2g17650`	Catalyzes the ligation of CoA on isovalerate to produce 3-methylbutanoyl-CoA.	No verified direct reference in this release
`At1g76290`	May act as an acid--thiol ligase that activates carboxylic acids by forming acyl-CoAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022227 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016405 CoA-ligase activity Molecular Function

GO:0016874 ligase activity Molecular Function

GO:0031956 medium-chain fatty acid-CoA ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G20560

ath:AT1G76290

ath:AT2G17650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.490

Rank 1 · TkA05G451970 · TK1151

Peroxisome0.291

Rank 2 · TkA05G451970 · TK1151

Nucleus0.135

Rank 3 · TkA05G451970 · TK1151

Mitochondrion0.090

Rank 4 · TkA05G451970 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA05G451970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501AMP-binding20-249 aa

PF00501AMP-binding250-383 aa

PF27854Heavy_Cys_CGP310-334 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G451970	`PF00501`	AMP-binding	20	249	8.1e-60	203.3
TkA05G451970	`PF00501`	AMP-binding	250	383	8.1e-60	203.3
TkA05G451970	`PF27854`	Heavy_Cys_CGP	310	334	0.76	9.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HUK6`	Arabidopsis thaliana	sp\|F4HUK6\|AAE1_ARATH Butanoate--CoA ligase AAE1	54.600%	Swiss-Prot	High
`Q9SEY5`	Arabidopsis thaliana	sp\|Q9SEY5\|AAE2_ARATH Isovalerate--CoA ligase AAE2	50.600%	Swiss-Prot	High
`Q9SFW5`	Arabidopsis thaliana	sp\|Q9SFW5\|AEE21_ARATH Probable acyl-activating enzyme 21	52.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card