TkA05G448730 | RubberDandelionOmics

Gene overview

TkA05G448730

Reference: TK1151 Chr: Chr05 Coordinates: 112171856-112173792 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1796 bp · TkA05G448730|TK1151|cDNA

AGATAAACTCAAACCAGAAACCTTTATTGACGAAACAAAAACCAAATTCCAAATAGCTAGCATACCCTTACCTTTTATGTATTCTCTACATAAAAAACAGACACTAAAATCTACAACACCACCATACGCCTCTAAACAACACTTTGCTCCAAAATTGCGAATTTCTAACTACAACAACACTTCACAATAAGAGACACCACGAAAATAAGAAAAAAGAAAAAAAGAGAGAGGTGTGCATAAGCATATATGATATAACATCA...

CDS

Download CDS FASTA

1158 bp · TkA05G448730|TK1151|CDS

ATGGATGATGATGATGATGATGATGATGGTGGGGTGGTTTTGGGTGCACCGAAAGTGATGGGTGTGGGTGAAGCGGAGGATGATGCCCCGAAGGAGAAGACTGGAGGGTTTTGTGGTGGTGGTTGTTGCCATGAAGAACCGAATACGGTTGTGGTGGTGGAATTACCGGATTTGGCCTCGGAGACTGGAGTGATGCCGAATGTAGGGGCGGAGGAGGTGAAAGGTGAGGTGGTTGGACCGGATGCAAACTGGAAAGGTGC...

Protein

Download Protein FASTA

386 aa · TkA05G448730|TK1151|PROTEIN

MDDDDDDDDGGVVLGAPKVMGVGEAEDDAPKEKTGGFCGGGCCHEEPNTVVVVELPDLASETGVMPNVGAEEVKGEVVGPDANWKGADWVVVVDDGFVWEVVVVLKKELVGVVVGDGELKPKRGEAVVVVVVVVEVEVVAGALKPKRAPLFVALVVVEVDGGAPKPKRAPPFVAAAAVVVVVEVVAGALKPKGEPPFVAVAVVEVAAGAPKLKRAPAFVAAEVVVVVVVEVAAGALNPKRPLPPLVAAAAVVVEVAAGEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G448730`
TK1151 ID	TkA05G448730
OH-1004 ID	LXL04_022169
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.500
Protein coverage (%)	TK1151 100.000 / OH-1004 89.463 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G448730`
Location	Chr05:112171856-112173792 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022169` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.368

Rank 1 · TkA05G448730 · TK1151

Cell membrane0.289

Rank 2 · TkA05G448730 · TK1151

Nucleus0.143

Rank 3 · TkA05G448730 · TK1151

Extracellular0.097

Rank 4 · TkA05G448730 · TK1151

Mitochondrion0.057

Rank 5 · TkA05G448730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19684DUF6186128-140 aa

PF27353MJ0401136-149 aa

PF27353MJ0401156-177 aa

PF19684DUF6186172-187 aa

PF27353MJ0401181-192 aa

PF27353MJ0401202-216 aa

PF27353MJ0401228-250 aa

PF19684DUF6186245-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G448730	`PF19684`	DUF6186	128	140	0.13	13.7
TkA05G448730	`PF27353`	MJ0401	136	149	4.8	7.5
TkA05G448730	`PF27353`	MJ0401	156	177	4.8	7.5
TkA05G448730	`PF19684`	DUF6186	172	187	0.13	13.7
TkA05G448730	`PF27353`	MJ0401	181	192	4.8	7.5
TkA05G448730	`PF27353`	MJ0401	202	216	4.8	7.5
TkA05G448730	`PF27353`	MJ0401	228	250	4.8	7.5
TkA05G448730	`PF19684`	DUF6186	245	256	0.13	13.7
TkA05G448730	`PF19684`	DUF6186	245	264	0.13	13.7
TkA05G448730	`PF19684`	DUF6186	268	310	0.13	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card