TkA05G445400 | RubberDandelionOmics

Gene overview

TkA05G445400

Reference: TK1151 Chr: Chr05 Coordinates: 111410695-111411271 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

315 bp · TkA05G445400|TK1151|cDNA

GAAGACAATAGAAAGACAAAATGGTGCCCTGCTCCTGGCTGTGACTATGCTGTTGACTTCATTGTTGGTGGTGGAACATTTGATGTTACATGTGGCTGCTCATATATTTTTTGCTGGAATTGTACCGAGGAAGCTCACTGCCGTGTTGATTGTGACACTGTGTCAAAGTGGATAATGAAAAACAGTGCAGAATCTGAAAACATGAATTGGATTTTAGCCAACTCAAAACCATGTCCCAAATGCAAGCGACCAATTGAGAA...

CDS

Download CDS FASTA

315 bp · TkA05G445400|TK1151|CDS

GAAGACAATAGAAAGACAAAATGGTGCCCTGCTCCTGGCTGTGACTATGCTGTTGACTTCATTGTTGGTGGTGGAACATTTGATGTTACATGTGGCTGCTCATATATTTTTTGCTGGAATTGTACCGAGGAAGCTCACTGCCGTGTTGATTGTGACACTGTGTCAAAGTGGATAATGAAAAACAGTGCAGAATCTGAAAACATGAATTGGATTTTAGCCAACTCAAAACCATGTCCCAAATGCAAGCGACCAATTGAGAA...

Protein

Download Protein FASTA

105 aa · TkA05G445400|TK1151|PROTEIN

EDNRKTKWCPAPGCDYAVDFIVGGGTFDVTCGCSYIFCWNCTEEAHCRVDCDTVSKWIMKNSAESENMNWILANSKPCPKCKRPIEKNQGCMHITCTPPCKFEFC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G445400`
TK1151 ID	TkA05G445400
OH-1004 ID	LXL04_035501
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 18.041 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G445400

Location Chr05:111410695-111411271 (+)

Description Similar to ARI8: Probable E3 ubiquitin-protein ligase ARI8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65430`	Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.	No verified direct reference in this release
`At2g31510`	Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.	No verified direct reference in this release
`At1g05890`	Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.	No verified direct reference in this release
`At1g63760`	Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.	No verified direct reference in this release
`At2g31780`	Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035501 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0031624 ubiquitin conjugating enzyme binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05890

ath:AT1G65430

ath:AT2G31510

ath:AT2G31770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.504

Rank 1 · TkA05G445400 · TK1151

Nucleus0.332

Rank 2 · TkA05G445400 · TK1151

Cell membrane0.087

Rank 3 · TkA05G445400 · TK1151

Endoplasmic reticulum0.085

Rank 4 · TkA05G445400 · TK1151

Peroxisome0.069

Rank 5 · TkA05G445400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01485IBR2-51 aa

PF22191IBR_15-44 aa

PF26200Rcat_RNF21612-46 aa

PF22605IBR_213-44 aa

PF22605IBR_248-66 aa

PF01485IBR68-105 aa

PF22191IBR_173-105 aa

PF22605IBR_274-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G445400	`PF01485`	IBR	2	51	1.1e-14	54.9
TkA05G445400	`PF22191`	IBR_1	5	44	8.1e-12	45.6
TkA05G445400	`PF26200`	Rcat_RNF216	12	46	0.026	15.8
TkA05G445400	`PF22605`	IBR_2	13	44	1.3e-08	35.6
TkA05G445400	`PF22605`	IBR_2	48	66	1.3e-08	35.6
TkA05G445400	`PF01485`	IBR	68	105	1.1e-14	54.9
TkA05G445400	`PF22191`	IBR_1	73	105	8.1e-12	45.6
TkA05G445400	`PF22605`	IBR_2	74	105	1.3e-08	35.6
TkA05G445400	`PF26200`	Rcat_RNF216	75	105	0.026	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W468`	Arabidopsis thaliana	sp\|Q8W468\|ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8	86.700%	Swiss-Prot	High
`Q84RR0`	Arabidopsis thaliana	sp\|Q84RR0\|ARI7_ARATH Probable E3 ubiquitin-protein ligase ARI7	81.900%	Swiss-Prot	High
`Q8L829`	Arabidopsis thaliana	sp\|Q8L829\|ARI5_ARATH Probable E3 ubiquitin-protein ligase ARI5	79.000%	Swiss-Prot	High
`P0C8K8`	Arabidopsis thaliana	sp\|P0C8K8\|ARI6_ARATH Putative E3 ubiquitin-protein ligase ARI6	74.500%	Swiss-Prot	High
`Q9SKC2`	Arabidopsis thaliana	sp\|Q9SKC2\|ARI11_ARATH Probable E3 ubiquitin-protein ligase ARI11	67.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card