TkA05G443710 | RubberDandelionOmics

Gene overview

TkA05G443710

Reference: TK1151 Chr: Chr05 Coordinates: 110891533-110892052 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · TkA05G443710|TK1151|cDNA

ATGGCCAGAGGTAAACCTAGAGTAGAATCCATACATATATTCGGTGAAATCAAGAAGGTTTTAGTACTCTACGACGGGGTTATACATTTTGCTGATTTAGAGTTAGCTAAACCCGTAAAGAAGATCGGCATTCTAAAAGATGTCAGTGCTATTGCTAGGAGGTTGAGGAGTAACGGAAATGAGGGTTTCACAAAGTTAACAGTCGGAGCTGGAGGAGACACAAGTAGCAGCTCGAGTTTTCTACAGAGATTAGGCGGCGA...

CDS

Download CDS FASTA

387 bp · TkA05G443710|TK1151|CDS

ATGGCCAGAGGTAAACCTAGAGTAGAATCCATACATATATTCGGTGAAATCAAGAAGGTTTTAGTACTCTACGACGGGGTTATACATTTTGCTGATTTAGAGTTAGCTAAACCCGTAAAGAAGATCGGCATTCTAAAAGATGTCAGTGCTATTGCTAGGAGGTTGAGGAGTAACGGAAATGAGGGTTTCACAAAGTTAACAGTCGGAGCTGGAGGAGACACAAGTAGCAGCTCGAGTTTTCTACAGAGATTAGGCGGCGA...

Protein

Download Protein FASTA

128 aa · TkA05G443710|TK1151|PROTEIN

MARGKPRVESIHIFGEIKKVLVLYDGVIHFADLELAKPVKKIGILKDVSAIARRLRSNGNEGFTKLTVGAGGDTSSSSSFLQRLGGDGGGGGGGRLNGGIADNLPIDEQFNEEIGEKTQIPSCAEHVT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G443710`
TK1151 ID	TkA05G443710
OH-1004 ID	LXL04_010596
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.700
Protein coverage (%)	TK1151 85.938 / OH-1004 10.911 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G443710`
Location	Chr05:110891533-110892052 (-)
Description	Similar to VPS3: Vacuolar sorting protein 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010596` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006886 intracellular protein transport Biological Process GO:0007165 signal transduction Biological Process GO:0008333 endosome to lysosome transport Biological Process GO:0010015 root morphogenesis Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0034058 endosomal vesicle fusion Biological Process GO:0035542 regulation of SNARE complex assembly Biological Process GO:0005737 cytoplasm Cellular Component GO:0005769 early endosome Cellular Component GO:0010008 endosome membrane Cellular Component
KEGG gene cross-reference	ath:AT1G22860 bta:514660 dre:565026 hsa:9392 mmu:73122 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.548

Rank 1 · TkA05G443710 · TK1151

Cytoplasm0.363

Rank 2 · TkA05G443710 · TK1151

Cell membrane0.059

Rank 3 · TkA05G443710 · TK1151

Mitochondrion0.059

Rank 4 · TkA05G443710 · TK1151

Golgi apparatus0.038

Rank 5 · TkA05G443710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05297Herpes_LMP156-122 aa

PF25184YxzE69-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G443710	`PF05297`	Herpes_LMP1	56	122	0.14	12.1
TkA05G443710	`PF25184`	YxzE	69	94	0.69	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card